CA2131729C - Helicobacter pylori proteins useful for vaccines and diagnostics - Google Patents

Helicobacter pylori proteins useful for vaccines and diagnostics Download PDF

Info

Publication number
CA2131729C
CA2131729C CA002131729A CA2131729A CA2131729C CA 2131729 C CA2131729 C CA 2131729C CA 002131729 A CA002131729 A CA 002131729A CA 2131729 A CA2131729 A CA 2131729A CA 2131729 C CA2131729 C CA 2131729C
Authority
CA
Canada
Prior art keywords
protein
polynucleotide
sequence
helicobacter pylori
amino acid
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Expired - Lifetime
Application number
CA002131729A
Other languages
French (fr)
Other versions
CA2131729A1 (en
Inventor
Antonello Covacci
Massimo Bugnoli
John Telford
Giovanni Macchia
Rino Rappuoli
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
GSK Vaccines SRL
Original Assignee
Chiron SRL
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from ITFI920052A external-priority patent/IT1262895B/en
Application filed by Chiron SRL filed Critical Chiron SRL
Priority to CA002383007A priority Critical patent/CA2383007A1/en
Publication of CA2131729A1 publication Critical patent/CA2131729A1/en
Application granted granted Critical
Publication of CA2131729C publication Critical patent/CA2131729C/en
Anticipated expiration legal-status Critical
Expired - Lifetime legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/04Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04Antibacterial agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/205Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Campylobacter (G)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/68Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
    • C12Q1/6876Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes
    • C12Q1/6888Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for detection or identification of organisms
    • C12Q1/689Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for detection or identification of organisms for bacteria
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/35Fusion polypeptide containing a fusion for enhanced stability/folding during expression, e.g. fusions with chaperones or thioredoxin
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/40Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y10TECHNICAL SUBJECTS COVERED BY FORMER USPC
    • Y10STECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y10S435/00Chemistry: molecular biology and microbiology
    • Y10S435/975Kit

Abstract

Helicobacter pylori is known to cause or be a cofactor in type B gastritis, peptic ulcers, and gastric tumors. In both deve-loped and developing countries, a high percentage of people are infected with this bacterium. The present invention relates gen-erally to certain H. pylori proteins, to the genes which express these proteins, and to the use of these proteins for diagnostic and vaccine applications. Specifically, molecular cloning, nucleotide, and amino acid sequences for the H. pylori cytotoxin (CT), the "Cytotoxin Associated Immunodominant" (CAI) antigen, and the heat shock protein (hsp60) are described herein.

Description

HELICOBACTER PYLORI PROTEINS
USEFUL FOR VACCINES AND DIAGNOSTICS
BACKGROUND OF THE INVENTION

1. Field of the Disclosure The present invention relates generally to certain Helicobacter pylori proteins, to the genes which express these proteins, and to the use of these proteins for diagnostic and vaccine applications. A divisional application directed to cytotoxin protein and their uses has been filed.
2. Brief Description of Related Art Helicobacter pylori is a curved, microaerophilic, gram negative bacterium that has been isolated for the first time in 1982 from stomach biopsies of patients with chronic gastritis, Warren et al., Lancet i:1273-75 (1983). Originally named Campylobacter pylori, it has been recognized to be part of a separate genus named Helicobacter, Goodwin et al., Int. J. Syst.
Bacteriol. 39:397-405 (1989). The bacterium colonizes the human gastric mucosa, and infection can persist for decades. During the last few years, the presence of the bacterium has been associated with chronic gastritis type B, a condition that may remain asymptomatic in most infected persons but increases considerably the risk of peptic ulcer and gastric adenocarcinoma. The most recent studies strongly suggest that H. pylori infection may be either a cause or a cofactor of type B gastritis, peptic ulcers, and gastric tumors, see e.g., Blaser, Gastroenterology 93:371-83 (1987); Dooley et al., New Engl. J. Med. 321:1562-66 (1989);
Parsonnet et al., New Engl. J. Med. 325:1127-31 (1991). H. pylori is believed to be transmitted by the oral route, Thomas et al., Lancet i:340, 1194 (1992), and the risk of infection increases with age, Graham et al., Gastroenterology 100:1495-1501 (1991), and is facilitated by crowding, Drumm et al., New Engl. J. Med.
4322:359-63 (1990); Blaser, Clin. Infect. Dis. 15:386-93 (1992).

la In developed countries, the presence of antibodies against H. pylori antigens increases from less than 20% to over 50% in people 30 and 60 years old respectively, Jones et al., Med.
Microbio. 22:57-62 (1986); Morris et al., N.Z. Med. J. 99:657-59 (1986), while in 2~31 1 &J -developing countries over 80% of the population are already infected by the age of 20, Graham et al., Digestive Diseases and Sciences 36:1084-88 (1991).
The nature and the role of the virulence factors of H. Aylori are still poorly understood. The factors that have been identified so far include the flagella that are probably necessary to move across the mucus layer, see e.g., Leying et al., Mol. Microbiol. 6:2863-74 (1992); the urease that is necessary to neutralize the acidic environment of the stomach and to allow initial colonization, see e.g., Cussac et al., J. Bacteriol. 174:2466-73 (1992); Perez-Perez et al., J. Infect. Immun. 60:3658-3663 (1992); Austin et al., J. Bacteriol. 174:7470-73 (1992); PCT Publ. No. WO
90/04030; and a high molecular weight cytotoxic protein formed by monomers allegedly having a molecular weight of 87 kDa that causes formation of vacuoles in eukaryotic epithelial cells and is produced by H. pylori strains associated with disease, see e.g., Cover et al., J. Bio.
Chem. 267:10570-75 (1992) (referencing a "vacuolating toxin"
with a specified 23 amino acid N-terminal sequence) ; Cover et al., J. Clin. Invest. 90:913-18 (1992); Leunk, Rev.
Infect. Dis. 13:5686-89 (1991). Additionally, the following is also known.
H. pylori culture supernatants have been shown by different authors to contain an antigen with a molecular weight of 120, 128, or 130 kDa, Apel et al., Aentralblat fur Bakteriol. Microb. und Hygiene 268:271-76 (1988); Crabtree et al., J. Clin. Pathol 45:733-34 (1992); Cover et al., Infect. Immun. 58:603-10 (1990); Figura et al., H. pylori, gastritis and peptic ulcer (eds. Malfrtheiner et al.), Springer Verlag, Berlin (1990). Whether the difference in size of the antigen described was due to interlaboratory differences in estimating the molecular weight of the same protein, to the size variability of the same antigen, or to actual different proteins was not clear. No nucleotide or amino acid sequence information was given about the protein.
This protein is very immunogenic in infected humans because specific antibodies are detected in sera of virtually all patients infected with H.pylori, Gerstenecker et al., Eur.
SUBSTiTU T E SHEET
J. Clin. Microbiol. 11:595-601 (1992).

H. pylori heat shock proteins (hsp) have been described, Evans et al., Infect. Immun. 60:2125-27 (1992) (44 amino acid N-terminal sequence and a molecular weight of about 62 kDa); Dunn et al., Infect. Immun. 60:1946-51 (1992) (33 amino acids found in the N-terminal sequence and a molecular weight of about 54 kDa);
Austin et al., J. Bacteriol. 174:7470-73 (1992) (37 amino acids found in the N-terminal sequence and a molecular weight of about 60 kDa). Austin et al. suggest that these are, in fact, the same protein with identical amino acid sequences at their N-terminus.
For examples of diagnostic tests based on H. pylori lysates or semipurified antigens, see Evans et al., Gastroenterology 96:1004-08 (1989); U.S. 4,882,271; PCT Publ. No. WO 89/08843 (all relating to compositions and assays containing the same having high molecular weight antigens (300-700 kDa) from the outer membrane surface with urease activity); EPO Publ. No. 329 570 (relating to antigenic compositions for detecting H. pylori antibodies having fragments of at least one fragment from the group 63, 57, 45, and 31 kDa).

The percentage of people infected by H. pylori, either in a symptomatic or an asymptomatic form, is very high in both developing and developed countries, and the cost of hospitalization and therapy makes desirable the development of both H. pylori vaccines and further diagnostic tests for this disease.

SUMMARY OF THE INVENTION

The present inventions describe nucleotide and amino acid sequences for three major H. pylori proteins. Specifically, these are the cytotoxin, the "Cytotoxin Associated Immunodominant" (CAI) antigen, and the heat shock protein. The invention of this parent application relates to the CAI antigen. The invention of the divisional application relates to the cytotoxin. None of the complete amino acid sequences for these proteins has been known, nor have their genes been identified. The present invention pertains to not only these purified proteins and their genes, but also recombinant materials associated therewith, such as vectors and host cells. The understanding at the molecular level or the nature and the role of these proteins and the availability of recombinant production has important implications for the development of new diagnostics for H. pylori and for the design of vaccines that may prevent H. pylori infection and treat disease.
The invention of the divisional application provides a recombinant Helicobacter pylori cytotoxin or a precursor, derivative or fragment thereof wherein the recombinant protein exhibits substantially no toxicity, or substantially reduced toxicity. In another embodiment this recombinant cytotoxin protein is chemically modified to reduce or abolish toxicity or to reduce or abolish functional contribution to toxicity.
In yet another embodiment the invention of this application provides a recombinant Helicobacter pylori cytotoxin associated immunodominant antigen or a derivative or fragment thereof wherein the recombinant protein is immunogenic and exhibits no functional contribution to toxicity, or a substantially reduced functional contribution to toxicity. In one embodiment this recombinant cytotoxin associated immunodominant antigen is chemically modified to reduce or abolish toxicity or to reduce or abolish functional contribution to toxicity.

The invention provides a protein selected from the group consisting of:
(a) a Helicobacter pylori cytotoxin associated immunodominant antigen having the amino acid sequence shown in Figure 4;
(b) a Helicobacter pylori cytotoxin associated immunodominant antigen having the amino acid sequence shown in Figure 4 modified by one or more conservative amino acid substitutions that do not substantially affect antigen function;
(c) a protein which can be immunologically identified by 4a an antibody which reacts specifically with the Helicobacter pylori cytotoxin associated immunodominant antigen of (a);
(d) a Helicobacter pylori cytotoxin associated imrnunodominant antigen comprising two repeats of amino acid sequence GRSVSPEPIYATIDDLGGPFPLKRHDKVDDLSKV;
(e) a protein comprising a fragment of the amino acid sequence shown in Figure 4, wherein said fragment is a portion of at least 11 amino acids from said sequence; and (f) the protein of (b), (c), (d) or (e) comprising amino acid sequence EFKNGKNKDFSK;
(g) the protein of (b), (c), (d) or (e) comprising amino acid sequence EPIYA; and (h) the protein of (b), (c), (d) or (e) comprising amino acid sequence NNNNNN.
As such, the proteins of this invention can be used in.both vaccine and diagnostic applications. The present invention includes methods for treating and diagnosing those diseases associated with H. pylori. As H. pylori has been associated with type B gastritis, peptic ulcers, and gastric adenocarcinoma, it is hoped that the present invention will assist in early detection and alleviation of these disease states. Currently, diagnosis relies mostly on endoscopy and histological staining of biopsies;
existing immunoassays are based on H. ovlori lysates or semi-purified antigens. Given the heterogeneity found in such assays, correlation with disease state is not yet well established. Thus, the potential for recombinant antigen-based immunoassays, as well as nucleic acid assays for disease detection, is great. At present, there is no commercial vaccine for H. pylori infection or treatment. A recombinant vaccine is thus an aspect of the present invention.
BRIEF DESCRIPTION OF THE DRAWINGS
Fig. 1 is the nucleotide sequence for the cytotoxin (CT) protein.
Fig. 2 is the amino acid sequence for the cytotoxin (CT) 4b protein.
Fig. 3 is a map of the cai gene for the CAI protein and summary of the clones used to identify and sequence this gene.
Fig. 4 is the nucleotide and amino acid sequences of the CAI
antigen.
Fig. 5 is the nucleotide and amino acid sequences of the heat shock protein (hsp).

DETAILED DESCRIPTION OF THE INVENTION
A. General Methodologv The practice of the present invention will employ, unless otherwise indicated, conventional techniques of molecular biolocry, microbiology, recombinant DNA, and immunology, which are within the skill of the art. Such > j,Y:':a,:: , .:.
5 techniques are explained fully iif''the literature. See e.g., Sambrook, et al.,, MOLECULAR CLONING; A LABORATORY MANUAL, SECOND EDITION (1.989); DNA CLONING, VOLUMES I AND II (D.N
Glover ed. 1985); OLIGONUCLEOTIDE SYNTHESIS (M.J. Gait ed, 1984) ; NUCLEIC AC:ID HYBRIDIZATION (B.D. Hames & S.J. Higgins eds. 1984); TRANSCRIPTION AND TRANSLATION (B.D. Hames & S.J.
Higgins eds. 1984); ANIMAL CELL CULTURE (R.I. Freshney ed.
1986); IMMOBILIZED CELLS AND ENZYMES (IRL*, Press, 1986); B.
Perbal, A PRACTICAL GUIDE TO MOLECULAR CLONING (1984); the series, METHODS I'N ENZYMOLOGY (Academic Press, Inc.); GENE
TRANSFER VECTORS FOR MAMMALIAN CELLS (J.H. Miller and M.P.
Calos eds. 1987, Cold Spring Harbor Laboratory), Methods in Enzymology Vol. 154 and Vol. 155 (Wu and Grossman, and Wu, eds., respectively), Mayer and Walker, eds. (1987), IMMUNOCHEMICAL METHODS IN CELL AND MOLECULAR BIOLOGY
(Academic Press, London), Scopes, (1987), PROTEIN
PURIFICATION: PR:INCIPLES AND PRACTICE, Second . Edition (Springer-Verlag, N.Y.), and HANDBOOK QF EXPERIMENTAL IM-MUNOLOGY, VOLUMES; I-IV (D.M. Weir and C. C. Blackwell eds 1986).
Standard abbreviations for nucleotides and amino acids are used in this specification.

B. Definitions "Cytoto,xin" or "toxin" of H. pylori refers to the protein, and frac;ments thereof, whose nucleotide sequence and amino acid sequences are shown in Figs. 1 and 2, respectively, anci their derivatives, and whose molecular weight is about 140 kDa. This protein serves as a precursor to a protein having an approximate weight of 100 kDa and having cytoxic activity. The cytotoxin causes vacuolation and death of a number of eukaryotic cell types and has been purified from H. 1Dylori culture supernatants. Additionally, SUf3STtTUTc SHEET
the cytotoxin is proteinaceous and has an apparent molecular mass determined by gel filtration of approximately 950-972 kDa. Denaturing gel electrophoresis of purified material previously revealed that the principal component of the 950-972 kDa molecule was allegedly,a polypeptide of apparent molecular mass of 87 kDa, Cover et al., J. Biol. Chem.
267:10570-75 1992). It is suggested herein, however, that the previously described 87 kDa results from either the further processing of the 100 kDa protein or from proteolytic degradation of a larger protein during purif ication .
The "Cytotoxin Associated Immunodominant" (CAI) antigen refers to that protein, and fragments thereof, whose amino acid sequence is described in Fig. 4 and derivatives thereof. This is an hydrophilic, surface-exposed protein having a molecular weight of approximately 120-132 kDa, preferably 128-130 kDa, produced by clinical isolates. The size of the gene and of the encoded protein varies in different strains by a mechanism that involves duplication of regions internal to the gene. The clinical isolates that do not produce the CAI antigen, do not have the cai gene, and are also unable to produce an active cytotoxin. The association between the presence of the cai gene and cytotoxicity suggests that the product of the cai gene is necessary for the transcription, folding, export or function of the cytotoxin. Alternatively, both the cytotoxin (CT) and the cai gene are absent in noncytotoxic strains. This would imply some physical linkage between the two genes. A
peculiar property of the CAI antigen is the size variability, suggesting that the cai gene is continuously changing. The CAI antigen appears to be associated to the cell surface. This suggests that the release of the antigen in the supernatant may be due to the action of proteases present in the serum that may cleave either the antigen itself, or the complexes that hold the CAI antigen associated to the bacterial surface. Similar processing activities may release the antigen during in vivo growth.
The absence of a typical leader peptide sequence suggests the presence of an independent export system.

SUF3S'T'ITUTc SHEET

WO 93/18150 PC,T/EP93/00472 "Heat shock protein" (hsp) refers to the H. pylori protein, and fragments thereof, whose amino acid sequence is given in Fig. 5 and derivatives thereof, and whose molecular weight is in the r.ange of 54-62 kDa, preferably about 58-60 kDa. This hsp belongs to the group of Gram negative bacteria heat shock proteins, hsp60. In general, hsp are among the most conserved proteins in all living organisms, either prokaryotic and eukaroytic, animals and plants, and the conservation is spread along the whole sequence. This high conservation, suggests a participation of the whole sequence at the functional structure of the protein that can be hardly modified without impairing its activity.
Examples of proteins that can be used in the present invention include polypeptides with minor amino acid variations from the natural amino acid sequence of the protein; in particular, conservative amino acid replacements are contemplated. Conservative replacements are those that take place within a family of amino acids that are related in their side chains. Genetically encoded amino acids are generally divided into four families: (1) acidic =
aspartate, glutamate; (2) basic = lysine, arginine, histidine; (3) non-polar = alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan;
and (4) uncharged polar = glycine, asparagine, glutamine, cystine, serine, threonine, tyrosine. Phenylalanine, tryptophan, and tyrosine are sometimes classified jointly as aromatic amino acids. For example, it is reasonably predictable that an isolated replacement of a leucine with an isoleucine or valine, an aspartate with a glutamate, a threonine with a serine, or a similar conservative replacement of an amino acid with a structurally related amino acid will not have a major effect on the biological activity. Polypeptide molecules having substantially the same amino acid sequence as the protein but possessing minor amino acid substitutions that do not substantially affect the functional aspects are within the definition of the protein.
A significant advantage of producing the protein by recombinant DNA techniques rather than by isolating and SUBS'T fTUTB SHEET

WO 93/18150 PC'T/EP93/00472 g purifying a protein from natural sources is that equivalent quantities of the protein can be produced by using less starting material than would be required for isolating the protein from a natural source. Producing the protein by recombinant techniques also permits the protein to be isolated in the absence of some molecules normally present in cells. Indeed, protein compositions entirely free of any trace of human protein contaminants can readily be produced because the only human protein produced by the recombinant non-human host is the recombinant protein at issue.
Potential viral agents from natural sources and viral components pathogenic to humans are also avoided.
The term "recombinant polynucleotide" as used herein intends a polynucleotide of genomic, cDNA, semisynthetic, or synthetic origin which, by virtue of its origin or manipulation: (1) is not associated with all or a portion of a polynucleotide with which it is associated in nature, (2) is linked to a polynucleotide other than that to which it is linked in nature, or (3) does not occur in nature. Thus, this term also encompasses the situation wherein the H. pylori bacterium genome is genetically modified (e.g., through mutagenesis) to produce one or more altered polypeptides.
The term "polynucleotide" as used herein refers to a polymeric form of a nucleotide of any length, preferably deoxyribonucleotides, and is used interchangeably herein with the terms "oligonucleotide" and "oligomer." The term refers only to the primary structure of the molecule. Thus, this term includes double- and single-stranded DNA, as well as antisense polynucleotides. It also includes known types of modifications, for example, the presence of labels which are known in the art, methylation, end "caps," substitution of one or more of the naturally occurring nucleotides with an analog, internucleotide modifications such as, for example, replacement with certain types of uncharged linkages (e.g., methyl phosphonates, phosphotriesters, phosphoamidates, carbamates, etc.) or charged linkages (e.g., phosphorothioates, phosphorodithioates, etc.), introduction of pendant moieties, such as, for example, SUBSTITUTE qHr--F-r WO 93/18150 - ~ e~131729 PCT/EP93/00472 proteins (including nucleases, toxins, antibodies, signal peptides, poly-Ii-lysine, etc.), intercalators (e.g., acridine, psoralen, etc.), chelators (e.g., metals, radioactive species, boron, oxidative moieties, etc.), alkylators (e.g., alpha anomeric nucleic acids, etc.).
By "genomic" is meant a collection or library of DNA molecules which are derived from restriction fragments that have been cloned in vectors. This may include all or part of the genetic material of an organism.
By "cDNA" is meant a complimentary mRNA sequence that hybridizes to a complimentary strand of mRNA.
As used herein, the term "oligomer" refers to both primers and probes and is used interchangeably herein with the term "polynucleotide." The term oligomer does not connote the size of the molecule. However, typically oligo-mers are no greater than 1000 nucleotides, more typically are no greater than 500 nucleotides, even more typically are no greater than 250 nucleotides; they may be no greater than 100 nucleotides, and may be no greater than 75 nucleotides, and also may be no greater than 50 nucleotides in length.
The term "primer" as used herein refexs to an oligomer which is capable of acting as a point of initiation of synthesis of a polynucleotide strand when used under appropriate conditions. The primer will be completely or substantially complementary to a region of the polynucleotide strand to be copied. Thus, under conditions conducive to hybridization, the primer will anneal to the complementary region of the analyte strand. Upon addition of suitable- reactants, (e.g., a polymerase, nucleotide triphosphates, and the like), the primer will be extended by the polymerizing agent to form a copy of the analyte strand.
The primer may be single-stranded or alternatively may be partially or fully double-stranded.
The terms "analyte polynucleotide" and "analyte strand" refer to a single- or double-stranded nucleic acid molecule which is suspected of containing a target sequence, and which may be present in a biological sample.
As used herein, the term "probe" refers to a structure comprised of a polynucleotide which forms a hybrid S US-S i iTU i E S KEET

structure with a target sequence, due to complementarily of at least one sequence in the probe with a sequence in the target region. The polynucleotide regions of probes may be composed of DNA, and/or RNA, and/or synthetic nucleotide 5 analogs. Included within probes are "capture probes" and "label probes".
As used herein, the term "target region" refers to a region of the nucleic acid which is to be amplified and/or detected. The term "target sequence" refers to a sequence 10 with which a probe or primer will form a stable hybrid under desired conditions.
The term "capture probe" as used herein refers to a polynucleotide probe comprised of a single-stranded polynucleotide coupled to a binding partner. The single-stranded polynucleotide is comprised of a targeting polynucleotide sequence, which is complementary to a target sequence in a target region to be detected in the analyte polynucleotide. This complementary region is of sufficient length and complementarily to the target sequence to afford a duplex of stability which is sufficient to immobilize the analyte polynucleotide to a solid surface (via the binding partners). The binding partner is specific for a second binding partner; the second binding partner can be bound to the surface of a solid support, or may be linked indirectly via other structures or binding partners to a solid support.
The term "targeting polynucleotide sequence" as used herein refers to a polynucleotide sequence which is comprised of nucleotides which are complementary to a target nucleotide sequence; the sequence is of sufficient length and complementarily with the target sequence to form a duplex which has sufficient stability for the purpose intended.
The term "binding partner" as used herein refers to a molecule capable of binding a ligand molecule with high specificity, as for example an antigen and an antibody specific therefor. In general, the specific binding part-ners must bind with sufficient affinity to immobilize the analyte copy/complementary strand duplex (in the case of SUBSTITUTE SKEcT

capture probes) under the isolation conditions. Specific binding partners are known in the art, and include, for example, biotin and avidin or streptavidin, IgG and protein A, the numerous known receptor-ligand couples, and complementary polynucleotide strands. In the case of complementary polynucleotide binding partners, the partners are normally at least about 15 bases in length, andmay be at least 40 bases in length; in addition, they have a content of Gs and Cs of at least about 40% and as much as about 60%. The polynucleotides may be composed of DNA, RNA, or synthetic nucleotide analogs.
The term "coupled" as used herein refers to at-tachment by covalent bonds or by strong non-covalent interactions (e.g., hydrophobic interactions, hydrogen bonds, etc.). Covalent bonds may be, for example, ester, ether, phosphoester, amide, peptide, imide, carbon-sulfur bonds, carbon-phosphorus bonds, and the like.
The term "support" refers to any solid or semi-solid surface to which a desired binding partner may be anchored. Suitable supports include glass, plastic, metal, polymer gels, and the like, and may take the form of beads, wells, dipsticks, membranes, and the like.
The term "label" as used herein refers to_ any atom or moiety which can be used to provide a detectable (preferably quantifiable) signal, and which can be attached to a polynucleotide or polypeptide.
As used herein, the term "label probe" refers to a polynucleotide probe which is comprised of a targeting polynucleotide secluence which is complementary to a target sequence to be detEacted in the analyte polynucleotide. This complementary region is of sufficient length and complementarily to the target sequence to afford a duplex comprised of the "label probe" and the "target sequence" to be detected by the label. The label probe is coupled to a label either directly, or indirectly via a set of ligand molecules with hicTh specificity for each other, including multimers.
The term "multimer," as used herein, refers to linear or branched polymers of the same repeating SUBSTITUTE SHEET

single-stranded polynucleotide unit or different single-stranded polynucleotide units. At least one of the units has a sequence, length, and composition that permits it to hybridize specifically to a first single-stranded nucleotide sequence of interest, typically an analyte or a polynucleotide probe (e.g., a label probe) bound to an analyte. In order to achieve such specificity and stability, this unit will normally be at least about 15 nucleotides in length, typically no more than about 50 nucleotides in length, and preferably about 30 nucleotides in length; moreover, the content of Gs and Cs will normally be at least about 40%, and at most about 60%. In addition to such unit(s), the multimer includes a multiplicity of units that are capable of hybridizing specifically and stably to a second single-stranded nucleotide of interest, typically a labeled polynucleotide or another multimer.
These units are generally about the same size and composition as the multimers discussed above. When a multimer is designed to be hybridized to another multimer, the first and second oligonucleotide units are heterogeneous (different), and do not hybridize with each other under the conditions of the selected assay. Thus, multimers may be label probes, or may be ligands which couple the label to the probe.
A "replicon" is any genetic element, e.g., a plasmid, a chromosome, a virus, a cosmid, etc. that behaves as an autonomous unit of polynucleotide replication within a cell; i.e., capable of replication under its own control.
This may include selectable markers.
"PCR" refers to the technique of polymerase chain reaction as described in Saiki, et al., Nature 324:163 (1986) ; and Scharf et al., Science (1986) 233:1076-1078; and U.S. 4,683,195; and U.S. 4,683,202.
As used herein, x is "heterologous" with respect to y if x is not naturally associated with y in the identical manner; i.e., x is not associated with y in nature or x is not associated with y in the same manner as is found in nature.
"Homology" refers to the degree of similarity SUBSTITUTE SHEET

between x and y. The correspondence between the sequence from one form to another can be determined by techniques known in the art. For example, they can be determined by a direct comparison of the sequence information of the polynucleotide. Alternatively, homology can be determined by hybridization of the polynucleotides under conditions which form stable duplexes between homologous regions (for example, those which would be used prior to S1 digestion), followed by digestion with single-stranded specific nuclease(s), followed by size determination of the digested fragments.
A "vector" is a replicon in which another polynucleotide seciment is attached, so as to bring about the replication and/or expression of the attached segment.
"Control sequence" refers to polynucleotide sequences which are necessary to effect the expression of coding sequences to which they are ligated. The nature of such control sequences differs depending upon the host organism; in prokaryotes, such control sequences generally include promoter, ribosomal binding site, and transcription termination sequence; in eukaryotes, generally, such,control sequences include promoters and transcription termination sequence. The term "control sequences" is intended to include, at a minimum, all components whose presence is necessary for expression, and may also include additional components whose presence is advantageous, for example, leader sequences and fusion partner sequences.
"Operably linked" refers to a juxtaposition wherein the components so described are in a relationship permitting them to function in their intended manner. A
control sequence "operably linked" to a coding sequence is ligated in such a way that expression of the coding sequence is achieved under conditions compatible with the control sequences.
An "operl reading frame" (ORF) is a region of a polynucleotide sequence which encodes a polypeptide; this region may represent a portion of a coding sequence or a total coding sequence.
A"codir,g sequence" is a polynucleotide sequence SUBST'ITUTE SHEET

WO 93/18150 PCf/EP93/00472 which is translated into a polypeptide, usually via mRNA, when placed under the control of appropriate regulatory sequences. The boundaries of the coding sequence are determined by a translation start codon at the 5'-terminus and a translation stop codon at the 3'-terminus. A coding sequence can include, but is not limited to, cDNA, and recombinant polynucleotide sequences.
As used herein, the term "polypeptide" refers to a polymer of amino acids and does not refer to a specific length of the product; thus, peptides, oligopeptides, and proteins are included within the definition of polypeptide.
This term also does not refer to or exclude post expression modifications of the polypeptide, for example, glycosylations, acetylations, phosphorylations and the like.
Included within the definition are, for example, polypeptides containing one or more analogs of an amino acid (including, for example, unnatural amino acids, etc.), polypeptides with substituted linkages, as well as other modifications known in the art, both naturally occurring and non-naturally occurring.
A polypeptide or amino acid sequence "derived from" a designated nucleic acid sequence refers to a polypeptide having an amino acid sequence identical to that of a polypeptide encoded in the sequence, or a portion thereof wherein the portion consists of at least 3-5 amino acids, and more preferably at least 8-10 amino acids, and even more preferably at least 11-15 amino acids, or which is immunologically identifiable with a polypeptide encoded in the sequence. This terminology also includes a polypeptide expressed from a designated nucleic acid sequence.
"Immunogenic" refers to the ability of a polypeptide to cause a humoral and/or cellular immune response, whether alone or when linked to a carrier, in the presence or absence of an adjuvant. "Neutralization" refers to an immune response that blocks the infectivity, either partially or fully, of an infectious agent.
"Epitope" refers to an antigenic determinant of a peptide, polypeptide, or protein; an epitope can comprise 3 or more amino acids in a spatial conformation unique to the SUBSTITUTE SHEET

213172;~
epitope. Generally, an epitope consists of at least 5 such amino acids and, more usually, consists of at least 8-10 such amino acicis. Methods of determining spatial conformation of amino acids are known in the art and 5 include, for example, x-ray crystallography and 2-dimensional nuclear magnetic resonance. Antibodies that recognize the same epitope can be identified in a simple immunoassay showing the ability of one antibody to block the binding of anothe:r antibody to a target antigen.
10 "Treatment," as used herein, refers to prophylaxis and/or therapy (i.e., the modulation of any disease symptoms). An "individual" indicates an animal that is susceptible to infection by H. pylori and includes, but is not limited to, primates, including humans. A "vaccine" is 15 an immunogenic, or otherwise capable of eliciting protection against H. pylori, whether partial or complete, composition useful for treatment of an individual.
The H. yylori proteins may be used for producing antibodies, either monoclonal or polyclonal, specific to the proteins. The methods for producing these antibodies are known in the art.
"Recombinant host cells", "host cells," "cells,"
"cell cultures," and other such terms denote, for example, microorganisms, irisect cells, and mammalian cells, that can be, or have been, used as recipients for recombinant vector or other transfer DNA, and include the progeny of the original cell which has been transformed. It is understood that the progeny of a single parental cell may not necessarily be completely identical in morphology or in genomic or total DNA complement as the original parent, due to natural, accidental, or deliberate mutation. Examples for mammalian host cells include Chinese hamster ovary (CHO) and monkey kidney (COS) cells.
Specifically, as used herein, "cell line," refers to a population of cells capable of continuous or prolonged growth and division in vitro. Often, cell lines are clonal populations derived from a single progenitor cell. It is further known in tihe art that spontaneous or induced changes can occur in karyotype during storage or transfer of such SUBSTITUTB SHBCT

clonal populations. Therefore, cells derived from the cell line referred to may not be precisely identical to the ancestral cells or cultures, and the cell line referred to includes such variants. The term "cell lines" also includes immortalized cells. Preferably, cell lines include nonhybrid cell lines or hybridomas to only two cell types.
As used herein, the.:term "microorganism" includes prokaryotic and eukaryotic microbial species such as bacteria and fungi, the latter including yeast and filamentous fungi.
"Transformation", as used herein, refers to the insertion of an exogenous polynucleotide into a host cell, irrespective of the method used for the insertion, for example, direct uptake, transduction, f-mating or electroporation. The exogenous polynucleotide may be maintained as a non-integrated vector, for example, a plasmid, or alternatively, may be integrated into the host genome.
By "purified" and "isolated" is meant, when referring to a polypeptide or nucleotide sequence, that the indicated molecule is present in the substantial absence of other biological macromolecules of the same type. The term "purified" as used herein preferably means at least 75% by weight, more preferably at least 85% by weight, more preferably still at least 95% by weight, and most preferably at least 98% by weight, of biological macromolecules of the same type present (but water, buffers, and other small molecules, especially molecules having a molecular weight of less than 1000, can be present).
C. Nucleic Acid Assays Using as a basis the genome of H. pylori, poly-nucleotide probes of approximately 8 nucleotides or more can be prepared which hybridize with the positive strand(s) of the RNA or its complement, as well as to cDNAs. These polynucleotides serve as probes for the detection, isolation and/or labeling of polynucleotides which contain nucleotide sequences, and/or as primers for the transcription and/or replication of the targeted sequences. Each probe contains a targeting polynucleotide sequence, which is comprised of SUSSTiTU T E SHEET

nucleotides which are complementary to a target nucleotide sequence; the sequence is of sufficient length and complementarily with the sequence to form a duplex which has sufficient stability for the purpose intended. For example, if the purpose is the isolation, via immobilization, of an analyte containing a target sequence, the probes will contain a polynucleotide region which is of sufficient length and complementarily to the targeted sequence to afford sufficient duplex stability to immobilize the analyte on a solid surface under the isolation conditions. For example, also, if the polynucleotide probes are to serve as primers for the transcription and/or replication of target sequences, the probes will contain a polynucleotide region of sufficient length and complementarily to the targeted sequence to allow for replication. For example, also, if the polynucleotidE: probes are to be used as label probes, or are to bind to multimers, the targeting polynucleotide region would be of' sufficient length and complementarily to form stable hybrid duplex structures with the label probes and/or multimers to allow detection of the duplex. The probes may contain a minimum of about 4 contiguous nucleotides whiclz are complementary ,to the targeted sequence; usually the oligomers will contain a 3ninimum of about 8 continuous nucleotides which are complementary to the targeted sequence, and preferably will contain a minimum of about 14 contiquous nucleotides which are complementary to the targeted sequence.
The probes, however, need not consist only of the sequence which is complementary to the targeted sequence.
They may contain additional nucleotide sequences or other moieties. For example, if the probes are to be used as primers for the amplification of sequences via PCR, they may contain sequences which, when in duplex, form restriction enzyme sites which facilitate the cloning of the amplified sequences. For example, also, if the probes are to be used .as "capture probes" in hybridization assays, they will be coupled to a "binding partner" as defined above.
Preparation of the probes is by means known in the art, including, for example, by methods which include excision, SUBSTtTUTB SHccT

transcription or chemical synthesis.
D. Expression Systems Once the appropriate H. pylori coding sequence is isolated, it can be expressed in a variety of different expression systems; for example those used with mammalian cells, baculoviruses, bacteria,and yeast.
i. Mammalian Systems Mammalian expression systems are known in the art.
A mammalian promoter is any DNA sequence capable of binding mammalian RNA polymerase and initiating the downstream (3') transcription of a coding sequence (e.g. structural gene) into mRNA. A promoter will have a transcription initiating region, which is usually placed proximal to the 5' end of the coding sequence, and a TATA box, usually located 25-30 base pairs (bp) upstream of the transcription initiation site. The TATA box is thought to direct RNA polymerase II
to begin RNA synthesis at the correct site. A mammalian promoter will also contain an upstream promoter element, usually located within 100 to 200 bp upstream of the TATA
box. An upstream promoter element determines the rate at which transcription is initiated and can act in either orientation, Sambrook et al., Molecular Cloning: A
Laboratory Manual, 2nd ed (1989).
Mammalian viral genes are often highly expressed and have a broad host range; therefore sequences encoding mammalian viral genes provide particularly useful promoter sequences. Examples include the SV40 early promoter, mouse mammary tumor virus LTR promoter, adenovirus major late promoter (Ad MLP), and herpes simplex virus promoter. In addition, sequences derived from non-viral genes, such as the murine metallotheionein gene, also provide useful promoter sequences. Expression may be either constitutive or regulated (inducible), depending on the promoter can be induced with glucocorticoid in hormone-responsive cells.
The presence of an enhancer element (enhancer), combined with the promoter elements described above, will usually increase expression levels. An enhancer is a regulatory DNA sequence that can stimulate transcription up to 1000-fold when linked to homologous or heterologous SUBST(TUTC SHEET

promoters, with synthesis beginning at the normal RNA start site. Enhancers are also active when they are placed upstream or downstream from the transcription initiation site, in either normal or flipped orientation, or at a distance of more than 1000 nucleotides from the promoter, Maniatis et al., Science 236:1237 (1989); Alberts et al.
Molecular Biology of the Cell, 2nd ed (1989). Enhancer elements derived from viruses may be particularly useful, because they usually have a broader host range. Examples include the SV40 early gene enhancer, Dijkema et al (1985) EMBO J. 4:761, and the enhancer/promoters derived from the long terminal repe:at (LTR) of the Rous Sarcoma Virus, Gorman et al. (1982) Proc. Natl. Acad. Sci. 79:6777, and from human cytomegalovirus, Boshart et al. (1985) Cell 41:5221.
Additionally, some enhancers are regulatable and become active only in the presence of an inducer, such as a hormone or metal ion, Sassone-Corsi et al. (1986) Trends Genet.
2:215; Maniatis et al. (1987) Science 236:1237.
A DNA molecule may be expressed intracellularly in mammalian cells. A promoter sequence may be directly linked with the DNA molecule, in which case the first amino acid at the N-terminus of the recombinant protein will always be a methionine, which is encoded by the ATG start codon. If desired, the N-tei_-minus may be cleaved from the protein by in vitro incubation with cyanogen bromide.
Alternatively, foreign proteins can also be secreted from the cell into the growth media by creating chimeric DNA molecules that encode a fusion protein comprised of-a leader sequence fragment that provides for secretion of the: foreign protein in mammalian cells.
Preferably, there are processing sites encoded between the leader fragment and the foreign gene that can be cleaved either in vivo or in vitro. The leader sequence fragment usually encodes a signal peptide comprised of hydrophobic amino acids which direct the secretion of the protein from the cell. The adenovirus tripartite leader is an example of a leader sequence that provides for secretion of a foreign protein in mammal:Lan cells.
Usually, transcription termination and SUBSTITUTE SHEET

%13112~ 20 polyadenylation sequences recognized by mammalian cells are regulatory regions located 3' to the translation stop codon and thus, together with the promoter elements, flank the coding sequence. The 3' terminus of the mature mRNA is formed by site-specific post-transcriptional cleavage and polyadenylation, Birnstiel et al. (1985) Cell 41:349;
Proudfoot and Whitelal*.'(1988) "Termination and 3' end processing of eukaryotic RNA. In Transcription and splicinq (ed. B.D. Hames and D.M. Glover); Proudfoot (1989) Trends Biochem. Sci. 14:105. These sequences direct the transcription of an mRNA which can be translated into the polypeptide encoded by the DNA. Examples of transcription terminator/polyadenylation signals include those derived from SV40, Sambrook et al (1989), Molecular Cloning: A
Laboratory Manual.
Some genes may be expressed more efficiently when introns (also called intervening sequences) are present.
Several cDNAs, however, have been efficiently expressed from vectors that lack splicing signals (also called splice donor and acceptor sites), see e.g., Gething and Sambrook (1981) Nature 293:620. Introns are intervening noncoding sequences within a coding sequence that contain,,.splice donor and acceptor sites. They are removed by a process called "splicing," following polyadenylation of the primary transcript, Nevins (1983) Annu. Rev. Biochem. 52:441; Green (1986) Annu. Rev. Genet. 20:671; Padgett et al. (1986) Annu.
Rev. Biochem. 55:1119; Krainer and Maniatis (1988) "RNA
splicing," In Transcription and splicing (ed. B.D. Hames and D.M. Glover):
Usually, the above-described components, comprising a promoter, polyadenylation signal, and transcription termination sequence are put together into expression constructs. Enhancers, introns with functional splice donor and acceptor sites, and leader sequences may also be included in an expression construct, if desired.
Expression constructs are often maintained in a replicon, such as an extrachromosomal element (e.g., plasmids) capable of stable maintenance in a host, such as mammalian cells or bacteria. Mammalian replication systems include those SUBSTITUTE SHEET

derived from animal viruses, which require trans-acting factors to replicate. For example, plasmids containing the replication systems of papovaviruses, such as SV40, Gluzman (1981) Cell 23:175, or polyomavirus, replicate to extremely high copy number in the presence of the appropriate viral T
antigen. Additional examples of mammalian replicons include those derived from bovine papillomavirus and Epstein-Barr virus. Additionally, the replicon may have two replication systems, thus allowing it to be maintained, for example, in mammalian cells for expression and in a procaryotic host for cloning and amplification. Examples of such mammalian-bacteria shuttle vectors include pMT2, Kaufman et al. (1989) Mol. Cell. Biol. 9:946, and pHEBO, Shimizu et al. (1986) Mol. Cell. Biol. 6:1074.
The transformation procedure used depends upon the host to be transformed. Methods for introduction of heterologous polyr.iucleotides into mammalian cells are known in the art and include dextran-mediated transfection, calcium phosphate precipitation, polybrene mediated transfection, protoplast fusion, electroporation, encapsulation of the polynucleotide(s) in liposomes, and direct microinjection of the DNA into nuaclei.
Mammalian cell lines available as 1zQsts for expression are known in the art and include many immortal-ized cell lines available from the American Type Culture Collection (ATCC), including but not limited to, Chinese hamster ovary (CHO) cells, HeLa cells, baby hamster kidney (BHK) cells, monkey kidney cells (COS), human hepatocellular carcinoma cells (e.g., Hep G2), and a number of other cell lines.
ii. Baculovirus Systems The polynucleotide encoding the protein can also be inserted into a suitable insect expression vector, and is operably linked to the control elements within that vector.
Vector construction employs techniques which are known in the art.
Generally, the components of the expression system include a transfer vector, usually a bacterial plasmid, which contains both a fragment of the baculovirus genome, S lJ~~T 4T U i E SH E E~' 13il ~9 22 and a convenient restriction site for insertion of the heterologous gene or genes to be expressed; a wild type baculovirus with a sequence homologous to the baculovirus-specific fragment in the transfer vector (this allows for the homologous recombinatiohof the heterologous gene in to the baculovirus genome); and appropriate insect host cells and growth media.
After inserting the DNA sequence encoding the protein into the transfer vector, the vector and the wild type viral genome are transfected into an insect host cell where the vector and viral genome are allowed to recombine.
The packaged recombinant virus is expressed and recombinant plaques are identified and purified. Materials and methods for baculovirus/insect cell expression systems are commercially available in kit form from, inter alia, Invitrogen, San Diego CA ("MaxBac" kit). These techniques are generally known to those skilled in the art and fully described in Summers and Smith, Texas Agricultural Experiment Station Bulletin No. 1555 (1987) (hereinafter "Summers and Smith").
Prior to inserting the DNA sequence encoding the protein into the baculovirus genome, the above-described components, comprising a promoter, leader (if 'desired), coding sequence of interest, and transcription termination sequence, are usually assembled into an intermediate transplacement construct (transfer vector). This construct may contain a single gene and operably linked regulatory elements; multiple genes, each with its owned set of operably linked regulatory elements; or multiple genes, regulated by the same set of regulatory elements.
Intermediate transpiacement constructs are often maintained in a replicon, such as an extrachromosomal element (e.g., plasmids) capable of stable maintenance in a host, such as a bacterium. The replicon will have a replication system, thus allowing it to be maintained in a suitable host for cloning and amplification.
Currently, the most commonly used transfer vector for introducing foreign genes into AcNPV is pAc373. Many other vectors, known to those of skill in the art, have also SUB30"TITUTc SKEET

WO 93/18150 2131729 PCr/EP93/00472 been designed. These include, for example, pVL985 (which alters the polyhedrin start codon from ATG to ATT, and which introduces a BamH7C cloning site 32 basepairs downstream from the ATT; see Luckow and Summers, Virology (1989) 17:31.
The plasmid usually also contains the polyhedron polyadenylation signal (Miller et al. (1988) Ann. Rev.
Microbiol., 42:177) and a procaryotic ampicillin-resistance (amn) gene and origin of replication for selection and propagation in E. coli.
Baculovirus transfer vectors usually contain a baculovirus promoter. A baculovirus promoter is any DNA
sequence capable of binding a baculovirus RNA polymerase and initiating the downstream (5' to 3') transcription of a coding sequence (e.g. structural gene) into mRNA. A
promoter will have a transcription initiation region which is usually placed proximal to the 5' end of the coding sequence. This transcription initiation region usually includes an RNA polymerase binding site and a transcription initiation site. A baculovirus transfer vector may also have a second domain called an enhancer, which, if present, is usually distal to the structural gene. Expression may be either regulated or constitutive.
Structu:ral genes, abundantly transcribed at late times in a viral infection cycle, provide particularly useful promoter sequences. Examples include sequences derived from the gene encoding the viral polyhedron protein, Friesen et al., (1986) "The Regulation of Baculovirus Gene Expression," in:'I'he Molecular Bioloqy of Baculoviruses (ed.
Walter poerfler); EPO Publ. Nos. 127 839 and 155 476; and the gene encoding the pl0 protein, Vlak et al., (1988), J.
Gen. Virol. 69:765.
DNA encoding suitable signal sequences can be derived from genes for secreted insect or baculovirus proteins, such as the baculovirus polyhedrin gene (Carbonell et al. (1988) Gene, 73:409). Alternatively, since the signals for mammalian cell posttranslational modifications (such as signal peptide cleavage, proteolytic cleavage, and phosphorylation) appear to be recognized by insect cells, and the signals required for secretion and nuclear SUBS ~ ITUTE SHEET

accumulation also appear to be conserved between the invertebrate cells and vertebrate cells, leaders of non-insect origin, such as those derived from genes encoding human a-interferon, Maeda et al., (1985), Nature 315:592;
human gastrin-releasing peptide, Lebacq-Verheyden et al., (1988), Molec. Cell. Biol. 8:3129; human IL-2, Smith et al., (1985) Proc. Nat'l Acad. Sci. USA, 82:8404; mouse IL-3, (Miyajima et al., (1987) Gene 58:273; and human glucocerebrosidase, Martin et al. (1988) DNA 7:99, can also be used to provide for secretion in insects.
A recombinant polypeptide or polyprotein may be expressed intracellularly or, if it is expressed with the proper regulatory sequences, it can be secreted. Good intracellular expression of nonfused foreign proteins usually requires heterologous genes that ideally have a short leader sequence containing suitable translation initiation signals preceding an ATG start signal. If desired, methionine at the N-terminus may be cleaved from the mature protein by in vitro incubation with cyanogen bromide.
Alternatively, recombinant polyproteins or proteins which are not naturally secreted can be secreted from the insect cell by creating chimeric DNA molecules that encode a fusion protein comprised of a leader sequence fragment that provides for secretion of the foreign protein in insects. The leader sequence fragment usually encodes a signal peptide comprised of hydrophobic amino acids which direct the translocation of the protein into the endoplasmic reticulum.
After insertion of the DNA sequence and/or the gene encoding the expression product precursor of the protein, an insect cell host is co-transformed with the heterologous DNA of the transfer vector and the genomic DNA
of wild type baculovirus -- usually by co-transfection. The promoter and transcription termination sequence of the construct will usually comprise a 2-5kb section of the baculovirus genome. Methods for introducing heterologous DNA into the desired site in the baculovirus virus are known in the art. (See Summers and Smith; Ju et al. (1987); Smith SUBSTITUTE SHEET

et al., Mol. Cell. Biol. (1983) 3:2156; and Luckow and Summers (1989))., For example, the insertion can be into a gene such as the: polyhedrin gene, by homologous double crossover recombination; insertion can also be into a 5 restriction enzyme site engineered into the desired baculovirus gene. Miller et al., (1989), Bioessays 4:91.
The DNA sequence, when cloned in place of the polyhedrin gene in the expression vector, is flanked both 5' and 3' by polyhedrin-specific sequences and is positioned 10 downstream of the polyhedrin promoter.
The newly formed baculovirus expression vector is subsequently packaged into an infectious recombinant baculovirus. Homologous recombination occurs at low frequency (between about 1% and about 5%); thus, the 15 majority of the virus produced after cotransfection is still wild-type virus. Therefore, a method is necessary to identify recombiriant viruses. An advantage of the expression system is a visual screen allowing recombinant viruses to be distinguished. The polyhedrin protein, which 20 is produced by thea native virus, is produced at very high levels in the nuclei of infected cells at late times after viral infection. Accumulated polyhedr-in protein forms occlusion bodies that also contain embedded particles.
These occlusion bodies, up to 15 n: in size, are highly 25 refractile, givincf them a bright shiny appearance that is readily visualized under the light microscope. Cells infected with recoinbinant viruses lack occlusion bodies. To distinguish recombinant virus from wild-type virus, the transfection - supei-natant is plaqued onto a monolayer of insect cells by techniques known to those skilled in the art. Namely, the plaques are screened under the light microscope for the presence (indicative of wild-type virus) or absence (indiceLtive of recombinant virus) of occlusion bodies. "Current Protocols in Microbiology" Vol. 2 (Ausubel et al. eds) at 16.8 (Supp. 10, 1990); Summers and Smith;
Miller et al. (1989).
Recombinant baculovirus expression vectors have been developed for infection into several insect cells. For example, recombinant baculoviruses have been developed for, SUBSTITUTE SHEET

inter alia: Aedes aegypti , Autographa californica, Bombyx mori, Drosophila melanogaster, Spodoptera frugiperda, and Trichoplusia ni (PCT Pub. No. WO 89/046699; Carbonell et al., (1985) J. Virol. 56:153; Wright (1986) Nature 321:718;
Smith et al., (1983) Mol. Cell. Biol. 3:2156; and see generally, Fraser, et al. (1989)''In Vitro Cell. Dev. Biol.
25:225).
Cells and cell culture media are commercially available for both direct and fusion expression of heterologous polypeptides in a baculovirus/expression system; cell culture technology is generally known to those skilled in the art. See, e.g., Summers and Smith.
The modified insect cells may then be grown in an appropriate nutrient medium, which allows for stable maintenance of the plasmid(s) present in the modified insect host. Where the expression product gene is under inducible control, the host may be grown to high density, and expression induced. Alternatively, where expression is constitutive, the product will be continuously expressed into the medium and the nutrient medium must be continuously circulated, while removing the product of interest and augmenting depleted nutrients. The product may be purified by such techniques as chromatography, e.g., HPLC,raffinity chromatography, ion exchange chromatography, etc.;
electrophoresis; density gradient centrifugation; solvent extraction, or the like. As appropriate, the product may be further purified, as required, so as to remove substantially any insect proteins which are also secreted in the medium or result from -lysis of insect cells, so as to provide a product which is at least substantially free of host debris, e.g., proteins, lipids and polysaccharides.
In order to obtain protein expression, recombinant host cells derived from the transformants are incubated under conditions which allow expression of the recombinant protein encoding sequence. These conditions will vary, dependent upon the host cell selected. However, the conditions are readily ascertainable to those of ordinary skill in the art, based upon what is known in the art.
iii. Bacterial Systems SUBSTITUTE SHEET

21.31729 Bacterial expression techniques are known in the art. A bacterial promoter is any DNA sequence capable of binding bacterial RNA polymerase and initiating the downstream (3") transcription of a coding sequence (e.g.
structural gene) into mRNA. A promoter will have a transcription initiation region which is usually placed proximal to the 5' end of the coding sequence. This transcription initiation region usually includes an RNA
polymerase bindincl site and a transcription initiation site.
A bacterial promoter may also have a second domain called an operator, that may overlap an adjacent RNA polymerase binding site at which RNA synthesis begins. The operator permits negative regulated (inducible) t--,?- sc;ntion, as a gene repressor protein may bind the opf:- ~d thereby inhibit transcription of a specific gene. stitutive expression may occur in the absence of negati ._egulatory elements, such as the operator. In additi~:;~,, positive regulation may be achieved by a gene activator protein binding sequence, which, if present is usually proximal (5') to the RNA polymerase binding sequence. An example of a gene activator protein is the catabolite activator protein (CAP), which helps; initiate transcriptiorl of the lac operon in E. coli, Raibaud et al. (1984) Annu. Rev. Genet. 18:173.
Regulated expression may therefore be either positive or negative, thereby either enhancing or reducing transcription.
Sequences encoding metabolic pathway enzymes provide particularly useful promoter sequences. Examples include promoter sequences derived from sugar metabolizing enzymes, such as galactose, lactose (lac), Chang et al.
(1977) Nature 198:1056, and maltose. Additional examples include promoter sequences derived from biosynthetic enzymes such as tryptophari (trg), Goeddel et al. (1980) Nuc. Acids Res. 8:4057; Yelverton et al. (1981) Nucl. Acids Res. 9:731;
U.S. 4,738,921; EPO Publ. Nos. 036 776 and 121 775. The g-laotamase (bla) promoter system, Weissmann (1981) "The cloning of interferon and other mistakes." In Interferon 3 .(ed. I. Gresser), bacteriophage lambda PL, Shimatake et al.
(1981) Nature 292:128, and T5, U.S. 4,689,406, promoter SUE3STfTUTE SHEET

~iw%9 systems also provide useful promoter sequences.
In addition, synthetic promoters which do not occur in nature also function as bacterial promoters. For example, transcription activation sequences of one bacterial or bacteriophage promoter'..may be joined with the operon sequences of another bacterial or bacteriophage promoter, creating a synthetic hybrid promoter, U.S. 4,551,433. For example, the tac promoter is a hybrid trQ-lac promoter comprised of both trp promoter and lac operon sequences that is regulated by the lac repressor, Amann et al. (1983) Gene 25:167; de Boer et al. (1983) Proc. Natl. Acad. Sci. 80:21.
Furthermore, a bacterial promoter can include naturally occurring promoters of non-bacterial origin that have the ability to bind bacterial RNA polymerase and initiate transcription. A naturally occurring promoter of non-bacterial ;;_-igin can also be coupled with a compatible RNA
polymerase to produce high levels of expression of some genes in prokaryotes. The bacteriophage T7 RNA
polymerase/promoter system is an example of a coupled promoter system, Studier et al. (1986) J. Mol. Biol.
189:113; Tabor et al. (1985) Proc Na.tl. Acad. Sci. 82:1074.
In addition, a hybrid promoter can alsQ_ be comprised of a bacteriophage promoter and an E. coli operator region (EPO
Publ. No. 267 851).
In addition to a functioning promoter sequence, an efficient ribosome binding site is also useful for the expression of foreign genes in prokaryotes. In E. coli, the ribosome binding site is called the Shine-Dalgarno (SD) sequence and includes an initiation codon (ATG) and a sequence 3-9 nucleotides in length located 3-11 nucleotides upstream of the initiation codon, Shine et al. (1975) Nature 254:34. The SD sequence is thought to promote binding of mRNA to the ribosome by the pairing of bases between the SD
sequence and the 3' and of E. coli 16S rRNA, Steitz et al.
(1979) "Genetic signals and nucleotide sequences in messenger RNA." In Biological Regulation and Development:
Gene Expression (ed. R.F. Goldberger). To express eukaryotic genes and prokaryotic genes with weak ribosome-binding site, Sambrook et al. (1989), Molecular Cloning: A
SUBSTITUTE SHEET

Laboratory Manual.
A DNA molecule may be expressed intracellularly.
A promoter sequence may be directly linked with the DNA
molecule, in which case. the first amino acid at the N-terminus will always be a methionine, which is encoded by the ATG start codon. If desired, methionine at the N-terminus may be cleaved from the protein by in vitro incubation with cyanogen bromide or by either in vivo on in vitro incubation with a bacterial methionine N-terminal peptidase (EPO Pu:bl. No. 219 237).
Fusion proteins provide an alternative to direct expression. Usually, a DNA sequence encoding the N-terminal portion of an endogenous bacterial protein, or other stable protein, is fused to the 5' end of heterologous coding sequences. Upon expression, this construct will provide a fusion of the two amino acid sequences. For example, the bacteriophage lambda cell gene can be linked at the 5' terminus of a foreign gene and expressed in bacteria. The resulting fusion protein preferably retains a site for a processing enzyme (factor Xa) to cleave the bacteriophage protein from the foreign gene, Nagai et al. (1984) Nature 309:810. Fusion proteins can also be made with sequences from the lacZ, Jia et al. (1987) Gene 60:197, trpE,_Allen et al. (1987) J. Biotechnol. 5:93; Makoff et al. (1989) J. Gen.
Microbiol. 135:11, and EPO Publ. No. 324 647, genes. The DNA sequence at the junction of the two amino acid sequences may or may not encode a cleavable site. Another example is a ubiquitin fusion protein. Such a fusion protein is made with the ubiquitin region that preferably retains a site for a processing enzyme (e.g. ubiquitin specific processing-protease) to cleave the ubiquitin from the foreign protein.
Through this method, native foreign protein can be isolated.
Miller et al. (19139) Bio/Technology 7:698.
Alternatively, foreign proteins can also be secreted from the cell by creating chimeric DNA molecules that encode a fusion protein comprised of a signal peptide sequence fragment that provides for secretion of the foreign protein in bacteria, U.S. 4,336,336. The signal sequence fragment usually encodes a signal peptide comprised of SUBSTITUTE SHEET

WO 93/18150 PCr/EP93/00472 hydrophobic amino acids which direct the secretion of the protein from the cell. The protein is either secreted into the growth media (gram-positive bacteria) or into the periplasmic space, located between the inner and outer 5 membrane of the cell (gram-negative bacteria). Preferably there are processing sites, which can be cleaved either in vivo or in vitro encoded between' the signal peptide fragment and the foreign gene.
DNA encoding suitable signal sequences can be 10 derived from genes for secreted bacterial proteins, such as the E. coli outer membrane protein gene (ompA). Masui et al.
(1983), in: Experimental Manipulation of Gene Expression;
Ghrayeb et al. (1984) EMBO J. 3:2437 and the E. coli alkaline phosphatase signal sequence (phoA), Oka et al.
15 (1985) Proc. Natl. Acad. Sci. 82:7212. As an additional example, the signal sequence of the alpha-amylase gene from various Bacillus strains can be used to secrete heterologous proteins from B. subtilis. Palva et al. (1982) Proc. Natl.
Acad. Sci. USA 79:5582; EPO Publ. No. 244 042.
20 Usually, transcription termination sequences recognized by bacteria are regulatory regions located 3' to the translation stop codon, and thus together with the promoter flank the coding sequence. These sequences direct the transcription of an mRNA which can be translated into 25 the polypeptide encoded by the DNA. Transcription termination sequences frequently include DNA sequences of about 50 nucleotides capable of forming stem loop structures that aid in terminating transcription. Examples include transcription termination sequences derived from genes with 30 strong promoters, such as the trp gene in E. coli as well as other biosynthetic genes.
Usually, the above-described components, comprising a promoter, signal sequence (if desired), coding sequence of interest, and transcription termination sequence, are put together into expression constructs.
Expression constructs are often maintained in a replicon, such as an extrachromosomal element (e.g., plasmids) capable of stable maintenance in a host, such as bacteria. The replicon will have a replication system, thus allowing it to SUBSTITUTE SHEET

WO 93/18150 ~ 13172 9 PCT/EP93/00472 be maintained in a procaryotic host either for expression or for cloning and amplification. In addition, a replicon may be either a high or low copy number plasmid. A high copy number plasmid will generally have a copy number ranging from about 5 to about 200, and usually about 10 to about 150. A host containing a high copy number plasmid will preferably contain at least about 10, and more preferably at least about 20 plasmids. Either a high or low copy number vector may be selected, depending upon the effect of the vector and the foreign protein on the host.
Alternatively, the expression constructs can be integrated into the bacterial genome with an integrating vector. Integrating vectors usually contain at least one sequence homologous to the bacterial chromosome that allows the vector to integrate. Integrations appear to result from recombinations between homologous DNA in the vector and the bacterial chromosome. For example, integrating vectors .constructed with DNA from various Bacillus strains integrate into the Bacillus chromosome (EPO Publ. No. 127 328).
Integrating vectors may also be comprised of bacteriophage or transposon sequences.
Usually, extrachromosomal and integrating expression constructs may contain selectable markers to allow for the selection of bacterial strains that have been transformed. Selectable markers can be expressed in the bacterial host and may include genes which render bacteria resistant to druqs such as ampicillin, chloramphenicol, erythromycin, kanamycin (neomycin), and tetracycline. Davies et al. (1978) Ar.inu. Rev.Microbiol. 32:469. Selectable markers may also include biosynthetic genes, such as those in the histidine, tryptophan, and leucine biosynthetic pathways.
Alternatively, some of the above-described components can be put together in transformation vectors.
Transformation vectors are usually comprised of a selectable marker that is either maintained in a replicon or developed into an integratirig vector.
Expression and transformation vectors, either extra-chromosomal replicons or integrating vectors, have SUBSTITUTE SHEET

been developed for transformation into many bacteria. For example, expression vectors have been developed for, inter alia, the following bacteria: Bacillus subtilis, Palv et al. (1982) Proc. Natl. Acad. Sci. USA 79:5582; EPO Publ.
Nos. 036 259 and 063 953; PCT Publ. No. WO 84/04541; E.
coli, Shimatake et al. (1981) Nature 292:128; Amann et al.
(1985) Gene 40:183; Studier et al. (1986) J. Mol. Biol.
189:113; EPO Publ. Nos. 036 776, 136 829 and 136 907;
Streptococcus cremoris, Powell et al. (1988) Appl. Environ.
Microbiol. 54:655; Streptococcus lividans, Powell et al.
(1988) Appl. Environ. Microbiol. 54:655; and Streptomyices lividans, U.S. 4,745,056.
Methods of introducing exogenous DNA into bacterial hosts are well-known in the art, and usually include either the transformation of bacteria treated with CaC12 or other agents, such as divalent cations and DMSO.
DNA can also be introduced into bacterial cells by electroporation. Transformation procedures usually vary with the bacterial species to be transformed. See, e.g., Masson et al. (1989) FEMS Microbiol. Lett. 60:273; Palva et al. (1982) Proc. Natl. Acad. Sci. USA 79:5582; EPO Publ.
Nos. 036 259 and 063 953; PCT Publ. No.- WO 84/04541, for Bacillus; Miller et al. (1988) Proc. Natl. Acad. Sci.
85:856; Wang et al. (1990) J. Bacteriol. 172:949, for Campylobacter; Cohen et al. (1973) Proc. Natl. Acad. Sci.
69:2110; Dower et al. (1988) Nucleic Acids Res. 16:6127;
Kushner (1978) "An improved method for transformation of E.
coli with ColEl-derived plasmids," In Genetic Enctineerincr:
Proceedings -of the International Symposium on Genetic Engineering (eds. H.W. Boyer and S. Nicosia); Mandel et al.
(1970) J. Mol. Biol. 53:159; Taketo (1988) Biochim. Biophys.
Acta 949:318, for Escherichia; Chassy et al. (1987) FEMS
Microbiol. Lett. 44:173, for Lactobacillus; Fiedler et al.
(1988) Anal. Biochem 170:38, for Pseudomonas; Augustin et al. (1990) FEMS Microbiol. Lett. 66:203, for Staphylococcus;
Barany et al. (1980) J. Bacteriol. 144:698; Harlander (1987) "Transformation of Streptococcus lactis by electroporation, in: Streptococcal Genetics (ed. J. Ferretti and R. Curtiss III); Perry et al. (1981) Infec. Immun. 32:1295; Powell et SUBSTITUTE Sa-lEcT

al. (1988) Appi. Environ. Microbiol. 54:655; Somkuti et al.
(1987) Proc. 4th Evr. Cong. Biotechnology 1:412, for Streptococcus.
iv. Yeast Expression Yeast expression systems are also known to one of ordinary skill in the art. A yeast promoter is any DNA
sequence capable of binding yeast RNA polymerase and initiating the downstream (3') transcription of a coding sequence (e.g. structural gene) into mRNA. A promoter will have a transcription initiation region which is usually placed proximal to the 5' end of the coding sequence. This transcription initiation region usually includes an RNA
polymerase binding site (the "TATA Box") and a transcription initiation site. A yeast promoter may also have a second domain called an upstream activator sequence (UAS), which, if present, is usually distal to the structural gene. The UAS permits regulated (inducible) expression. Constitutive expression occurs in the absence of a UAS. Regulated expression may be either positive or negative, thereby either enhancing or reducing transcription.
Yeast is a fermenting organism with an, active metabolic pathway, therefore sequences epcoding enzymes in the metabolic pathway provide particularly usefu3promoter sequences. Examples include alcohol dehydrogenase (ADH) (EPO Publ. No. 284 044), enolase, glucokinase, glucose-6-phosphate isomerase, glyceraldehyde-3-phosphate-dehydrogenase (GAP or GAPDH), hexokinase, phosphofructokinas.e, 3-phosphoglyceratemutase, and pyruvate kinase (PyK) -(EPO Publ. No. 329 203). The yeast PHO5 gene, encoding acid phosphatase, also provides useful promoter sequences, Myanohara et al. (1983) Proc. Natl. Acad. Sci.
USA 80:1.
In addition, synthetic promoters which do not occur in nature also function as yeast promoters. For example, UAS sequences of one yeast promoter may be joined with the transcription activation region of another yeast promoter, creating a synthetic hybrid promoter. Examples of such hybrid promoters include the ADH regulatory- sequence linked to the GAP transcription activation region (U.S.
SUSSTMUTi E SHEET

A ~ 34 ,876,197 and U.S. 4,880,734). Other examples of hybrid promoters include promoters which consist of the regulatory sequences of either the ADH2, GAL4, GAL10, or PHO5 genes, combined with the transcriptional activation region of a glycolytic enzyme gene such'as..GAP or PyK (EPO Publ. No. 164 556). Furthermore, a yeastpromoter can include naturally occurring promoters of non-yeast origin that have the ability to bind yeast RNA polymerase and initiate transcription. Examples of such promoters include, inter alia, Cohen et al. (1980) Proc. Nati. Acad. Sci. USA
77:1078; Henikoff et al. (1981) Nature 283:835; Hollenberg et al. (1981) Curr. Topics Microbiol. Immunol. 96:119;
Hollenberg et al. (1979) "The Expression of Bacterial Antibiotic Resistance Genes in the Yeast Saccharomyces cerevisiae," in: Plasmids of Medical, Environmental and Commercial Importance (eds. K.N. Timmis and A. Puhler) ;
Mercerau-Puigalon et al. (1980) Gene 11:163; Panthier et al.
(1980) Curr. Genet. 2:109.
A DNA molecule may be expressed intracellularly in yeast. A promoter sequence may be directly linked with the DNA molecule, in which case the first amino acid at the N-terminus of the recombinant protein will always be a methionine, which is encoded by the ATG start codon. if desired, methionine at the N-terminus may be cleaved from the protein by in vitro incubation with cyanogen bromide.
Fusion proteins provide an alternative for yeast expression systems, as well as in mammalian, baculovirus, and bacterial expression systems. Usually, a DNA sequence encoding the N-terminal portion of an endogenous yeast protein, or other stable protein, is fused to the 5' end of heterologous coding sequences. Upon expression, this construct will provide a fusion of the two amino acid sequences. For example, the yeast or human superoxide dismutase (SOD) gene, can be linked at the 5' terminus of a foreign gene and expressed in yeast. The DNA sequence at the junction of the two amino acid sequences may or may not encode a cleavable site. See e.g., EPO Publ. No. 196 056.
Another example is a ubiquitin fusion protein. Such a fusion protein is made with the ubiquitin region that StJSSi1TU i c SHEET

preferably retains a site for a processing enzyme (e.g.
ubiquitin-specific processing protease) to cleave the ubiquitin from the foreign protein. Through this method, therefore, native foreign protein can be isolated (see, 5 e.g., PCT Publ. No. WO 88/024066).
Alternatively, foreign proteins can also be secreted from the cell into the growth media by creating chimeric DNA molecules that encode a fusion protein comprised of a leader sequence fragment that provide for 10 secretion in yeast of the foreign protein. Preferably, there are processing sites encoded between the leader fragment and the foreign gene that can be cleaved either iin vivo or in vitro. The leader sequence fragment usually encodes a signal peptide comprised of hydrophobic amino 15 acids which direct the secretion of the protein from the cell.
DNA encoding suitable signal sequences can be derived from genes for secreted yeast proteins, such as the yeast invertase gene (EPO Publ. No. 012 873; JPO Publ. No.
20 62,096,086) and the A-factor gene (U.S. 4,588,684).
Alternatively, leaders of non-yeast origin, such as an interferon leader, exist that also provide for secretion in yeast (EPO Publ. No. 060 057).
A preferred class of secretion leaders are those 25 that employ a fraginent of the yeast alpha-factor gene, which contains both a "pre" signal sequence, and a "pro" region.
The types of alpha-factor fragments that can be employed include the full-length pre-pro alpha factor leader (about 83 amino acid residues) as well as truncated alpha-factor 30 leaders (usually about 25 to about 50 amino acid residues) (U.S. 4,546,083 and U.S. 4,870,008; EPO Pubi. No. 324 274).
Additional leaders employing an alpha-factor leader fragment that provides for secretion include hybrid alpha-factor leaders made with a presequence of a first yeast, but a pro-35 region from a second yeast alphafactor. (See e.g., PCT
Publ. No. WO 89/02463.) Usually, transcription termination sequences recognized by yeast are regulatory regions located 3' to the translation stop codon, and thus together with the promoter ~
SUBSTITUTE St-lSE

WO 93/18150 PC.'I'/EP93/00472 flank the coding sequence. These sequences direct the transcription of an mRNA which can be translated into the polypeptide encoded by the DNA. Examples of transcription terminator sequence and other yeast-recognized termination sequences, such as those coding for glycolytic enzymes.
Usually, the above-described components, comprising a promoter, leader (if desired), coding sequence of interest, and transcription termination sequence, are put together into expression constructs. Expression constructs are often maintained in a replicon, such as an extrachromosomal element (e.g., plasmids) capable of stable maintenance in a host, such as yeast or bacteria. The replicon may have two replication systems, thus allowing it to be maintained, for example, in yeast for expression and in a procaryotic host for cloning and amplification.
Examples of such yeast-bacteria shuttle vectors include YEp24, Botstein et al. (1979) Gene 8:17-24; pCl/i, Brake et al. (1984) Proc. Natl. Acad. Sci USA 81:4642-4646; and YRp17, Stinchcomb et al. (1982) J. Mol. Biol. 158:157. In addition, a replicon may be either a high or low copy number plasmid. A high copy number plasmid will generally have a copy number ranging from about 5 to about 200, and usually about 10 to about 150. A host containing a high cbgy number plasmid will preferably have at least about 10, and more preferably at least about 20. A high or low copy number vector may be selected, depending upon the effect of the vector and the foreign protein on the host.
Alternatively, the expression constructs can be integrated into the yeast genome with an integrating vector.
Integrating vectors usually contain at least one sequence homologous to a yeast chromosome that allows the vector to integrate, and preferably contain two homologous sequences flanking the expression construct. Integrations appear to result from recombinations between homologous DNA in the vector and the yeast chromosome, Orr-Weaver et al. (1983) Methods in Enzymol. 101:228-245. An integrating vector may be directed to a specific locus in yeast by selecting the appropriate homologous sequence for inclusion in the vector.
One or more expression construct may integrate, possibly SUBSTITUTE SHEET

WO 93/18150 2131729 PCr/EP93/00472 affecting levels of recombinant protein produced, Rine et al. (1983) Proc. Natl. Acad. Sci. USA 80:6750. The chromosomal sequences included in the vector can occur either as a single segment in the vector, which results in the integration of the entire vector, or two segments homologous to ad,jacent segments in the chromosome and flanking the expression construct in the vector, which can result in the stable integration of only the expression construct.
Usually, extrachromosomal and integrating expression constructs may contain selectable markers to allow for the selection of yeast strains that have been transformed. Selectable markers may include biosynthetic genes that can be expressed in the yeast host, such as ADE2, HIS4, LEU2, TRP1, and ALG7, and the G418 resistance gene, which confer resistance in yeast cells to tunicamycin and G418, respectively. In addition, a suitable selectable marker may also provide yeast with the ability to grow in the presence of toxic compounds, such as metal. For example, the prese:nce of CUP1 allows yeast to grow in the presence of copper ions. Butt et al. (1987) Microbiol, Rev.
51:351.
Alternatively, some of the above-described components can be put together into transformation vectors.
Transformation vectors are usually comprised of a selectable marker that is either maintained in a replicon or developed into an integratinig vector.
Expression and transformation vectors, either extrachromosoznal replicons or integrating vectors, have been developed for transformation into many yeasts. For example, expression vectors have been develaped for, inter alia, the following yeasts: Candida albicans, Kurtz, et al. (1986) Mol. Cell. Biol. 6:142; Candida maltosa, Kunze, et al.
(1985) J. Basic Microbiol. 25:141; Hansenula polymorpha, Gleeson, et al. (1986) J. Gen. Microbiol. 132:3459;
Roggenkamp et al. (1986) Mol. Gen. Genet. 202:302;
Kluyveromyces fragilis, Das, et al. (1984) J. Bacteriol.
158:1165; Kluyveromyices lactis, De Louvencourt et al. (1983) J. Bacteriol. 154:737; Van den Berg et al. (1990) SUBSTITUTE SHEET

WO 93/18150 PC'I'/EP93/00472 213ijZ5 38 Bio/Technology 8:135; Pichia guillerimondii, Kunze et al.
(1985) J. Basic Microbiol. 25:141; Pichia pastoris, Cregg, et al. (1985) Mol. Cell. Biol. 5:3376; U.S. 4,837,148 and U.S. 4,929,555; Saccharomyces cerevisiae, Hinnen et al.
(1978) Proc. Natl. Acad. Sci. USA 75:1929; Ito et al. (1983) J. Bacteriol. 153:163; Schizosaccharomyces pombe, Beach et al. (1981) Nature 300:706; and Yarrowia liRolytica, Davidow, et al. (1985) Curr. Genet. 10:380471 Gaillardin, et al.
(1985) Curr. Genet. 10:49.
Methods of introducing exogenous DNA into yeast hosts are well-known in the art, and usually include either the transformation of spheroplasts or of intact yeast cells treated with alkali cations. Transformation procedures usually vary with the yeast species to be transformed. See e.g., Kurtz et al. (1986) Mol. Cell. Biol. 6:142; Kunze et al. (1985) J. Basic Microbiol. 25:141, for Candida; Gleeson et al. (1986) J. Gen. Microbioy. 132:3459; Roggenkamp et al.
(1986) Mol. Gen. Genet. 202:302, for Hansenula; Das et al.
(1984) J. Bacteriol. 158:1165; De Louvencourt et al. (1983) J. Bacteriol. 154:1165; Van den Berg et al. (1990) Bio/Technology 8:135, for Kluyveromyces; Cregg et al. (1985) Mol. Cell. Biol. 5:3376; Kunze et al,,. (1985) J. Basic Microbiol. 25:141; U.S. 4,837,148 and U.S. 4,92,9,4555, for Pichia; Hinnen et al. (1978) Proc. Natl. Acad. Sci. USA
75;1929; Ito et al. (1983) J. Bacteriol. 153:163, for Saccharomyces; Beach et al. (1981) Nature 300:706, for Schizosaccharomyces; Davidow et al. (1985) Curr. Genet.
10:39; Gaillardin et al. (1985) Curr. Genet. 10:49, for Yarrowia.
E. Vaccines Each of the H. pylori proteins discussed herein may be used as a sole vaccine candidate or in combination with one or more other antigens, the latter either from H.
pylori or other pathogenic sources. Preferred are ."cocktail" vaccines comprising, for example, the cytQtoxin (CT) anti en, the CAI
g protein, and the urease., Additionally, the hsp can be added to one or more of-these components. These vaccines may either be prophylactic (to SUBSTITUTE SHEET

prevent infection) or therapeutic (to treat disease after infection).
Such veiccines comprise H. pylori antigen or antigens, usually in combination with "pharmaceutically ~l.'.~.=_''= '-acceptable carriers", which incl+~an'y carrier that does not itself induce the production of antibodies harmful to the individual receiving the composition. Suitable carriers are typically large, slowly metabolized macromolecules such as proteins, polysaccharides, polylactic acids, polyglycolic acids, polymeric amino acids, amino acid copolymers, lipid aggregates (such as oil droplets or lipcasomes) , and inactive virus particles. Such carriers are well known to those of ordinary skill in the art. Additionally, these carriers may function as imununostimulating agents ("adjuvants").
Furthermore, the antigen may be conjugated to a bacterial toxoid, such as a toxoid from diphtheria, tetanus, cholera, H. pylori, etc. pathogens.
Preferred adjuvants to enhance effectiveness of the composition include, but are not limited to: (1) aluminum salts (alum), such as aluminum hydroxide, aluminum phosphate, aluminiam sulfate, etc; (2) oil-in-water emulsion formulations (with or without - other specific immunostimulating agents such as muramyl peptides (see below) or bacterial cell wall components), such as for example (a) MF59 (PCT Publ. No. WO 90/14837), containing 5%
Squalene, 0.5% Tween 80; and 0.5% Span* 85 (optionally containing various amounts of MTP-PE (see below), although not required) foi-mulated into submicron particles using a microfluidizer such as Model 110Y microf luidizer (Microfluidics, Newton, MA), (b) SAF, containing 10%
Squalane, 0.4% Tween 80, 5% pluronic-blocked polymer L121, and thr-MDP (see below) either microfluidized into a submicron emulsion or vortexed to generate a larger particle size emulsion, and (c) RibiTM adjuvant system (RAS), (Ribi Zmmunochem, Hamilton, MT) containing 2% Squalene, 0.2% Tween 80, and one or more bacterial cell wall components from the group consisting of monophosphorylipid A(MPL), trehalose dimycolate (TDM),, and cell wall skeleton (CWS), preferably MPL + CWS (De1:,oxTM) ; (3) saponin adjuvants, such as *trade-mark SUBSTITUTE SHcET

StimulonTM (Cambridge Bioscience, Worcester, MA) may be used or particles generated therefrom such as ISCOMs (immunostimulating complexes); (4) Complete Freunds Adjuvant (CFA) and Incomplete Freunds Adjuvant (IFA); (5) cytokines, 5 such as interleukins (IL-i, IL-2, etc.), macrophage colony stimulating factor (M-CSF), tumor necrosis factor (TNF), etc; and (6) other substances.that act as immunostimulating agents to enhance the effectiveness of the composition.
Alum and MF59 are preferred.
10 As mentiLoned above, muramyl peptides include, but are not limited to, N-acetyl-muramyl-L-threonyl-D-isoglutamine (thr-.MDP), N-acetyl-normuramyl-L-alanyl-D-iso-glutamine (nor-MDP), N-acetylmuramyl-L-alanyl-D-isoglutaminyl-L-alanine-2-(1'-2'-dipalmitoyl-sn-glycero-3-15 huydroxyphosphory].oxy)-ethylamine (MTP-PE), etc.
The immunogenic compositions (e.g., the antigen, pharmaceutically acceptable carrier, and adjuvant) typically will contain diluents, such as water, saline, glycerol, ethanol, etc. Addlitionally, auxiliary substances, such as 20 wetting or emulsifying agents, pH buffering substances, and the like, may be present in such vehicles.
Typically, the immunogenic y"compositions are prepared as injectables, either as liquid solutions or suspensions; solid forms suitable for solution in, or 25 suspension in, liquid vehicles prior to injection may also be prepared. The preparation also may be emulsified or encapsulated in liposomes for enhanced adjuvant effect, as discussed above under pharmaceutically acceptable carriers.

30 Immunogenic compositions used as vaccines comprise an immunologically effective amount of the antigenic polypeptides, as well as any other of the above-mentioned components, as needed. By "immunologically effective amount", it is mearit that the administration of that amount 35 to an individual, either in a single dose or as part of a series, is effective for treatment or prevention. This amount varies depending upon the health and physical condition of the individual to be treated, the taxonomic group of individual to be treated (e.g., nonhuman primate, SUEtSTfTt.}TE SHEET

WO 93/18150 2~ ~ ~ ~ ~ ~ PCT/EP93/00472 primate, etc.), the capacity of the individual's immune system to synthesize antibodies, the degree of protection desired, the fo:rmulation of the vaccine, the treating doctor's assessment of the medical situation, and other rel-evant factors. It is expected that the amount will fall in a relatively broad range that can be determined through routine trials.
The immunogenic compositions are conventionally administered parenterally, e.g., by injection, either subcu-taneously or in'tramuscularly. Additional formulations suitable for other modes of administration include oral and pulmonary formulations, suppositories, and transdermal applications. Oral formulations are most preferred for the H. pvlori proteins. Dosage treatment may be a single dose schedule or a multiple dose schedule. The vaccine may be administered in conjunction with other immunoregulatory agents.
F. Immunodiagnostic Assays H. pylori antigens can be used in immunoassays to detect antibody l4=_vels (or conversely H. ply ori antibodies can be used to detect antigen levels) and correlation can be made with gastroduodenal disease and wit4 duodenal ulcer in particular. Immunoassays based on well defined, recombinant antigens can be developed to replace the invasive diagnostics methocis that are used today. Antibodies to H.
pylori proteins within biological samples, including for example, blood or serum samples, can be detected. Design of the immunoassays is subject to a great deal of variation, and a variety of these are known in the art. Protocols for the immunoassay may be based, for example, upon competition, or direct reaction, or sandwich type assays. Protocols may also, for example, use solid supports, or may be by immunoprecipitation. Most assays involve the use of labeled antibody or polypeptide; the labels may be, for example, fluorescent, chemiluminescent, radioactive, or dye molecules. Assays which amplify the signals from the probe are also known; examples of which are assays which utilize biotin and avid:in, and enzyme-labeled and mediated immunoassays, such as ELISA assays.

SUBSTITUTE SHEET

Kits suitable for immunodiagnosis and containing the appropriate labeled reagents are constructed by packaging the appropriate materials, including the compositions of the invention, in suitable containers, along with the remaining reagents and<~afa~erials (for example, suitable buffers, salt solutions, etc..) required for the conduct of the assay, as well as suitable set of assay instructions.
G. Examples The examples presented below are provided as a further guide to the practitioner of ordinary skill in the art and are not to be construed as limiting,.:the invention in any way.
i. H. pylori cytotoxin (CT) anticien 1. Materials and methods For general materials and methods relating to i~.
pylori growth and. DNA isolation, see sections ii and iii below, relating to CAI antigen and hsp, respectively.
a. Cloning Two mixtures of degenerate oligonucleotides were *
synthesized usinci an Applied Biosystems model 380B DNA
synthesizer. These mixtures were used at a concentration of 4 micromolar in a 100 microliter polymerase chain reaction with 200 nanograms of purified DNA using the Genamp* PCR kit according to the manufacturers instructions. The reaction was incubated for 1 minute at 94 degrees centigrade, 2 minutes at 48 degrees centigrade and 2 minutes at 56 degrees centigrade. The reaction mix was subjected to 30 cycles of these conditions.
Analysis of the products of this reaction by agarose gel e:lectrophoresis revealed a prominent approximately 87 bp DNA fragment. After digestion with the restriction enzymes XbaI and EcoRI, the fragment was ligated to the Bluscript SK+* (Stratgene) plasmid which had previouslv also been digested with XbaI and EcoRI. The ligation mixture was used to transform competent E. coli by electroporation at 2000V and 25 microfarads using (200 D) a BioRad Gene Pulser* (California). Transformed E. coli were selected for growth on L-agar plates containing 100 *trade-mark SUBSTITUTE SHEET

WO 93/18150 PCr/EP93/00472 micrograms per milliliter ampicillin. Plasmid DNA was extracted from positive E.coli isolates and subjected to sequence analysis using the Sequenase 2* (United States Biochemical Corporation) DNA sequencing kit according to the manufacturers instructions.
b. Preparation of libraries (1) Library of HindiII fragments Seven micrograms of purified DNA were digested to completion with the restriction enzyme- HindII. Three micrograms of Blu.escript.SK+ plasmid DNA were digested to completion with HfindIII then treated,..with calf 'intestinal phosphatase.' Both. DNA mixtures were purified by agitation with a water saturated phenol then precipitated by addition of ethyl alcohol to 67% V/V. Both DNAs were resuspended in 50 microliters of water. 0.7 micrograms of DNA fragments were mixed with 0.3 micrograms of Bluescript DNA in 50 microliters of a solution containing 25 mM Tris ph 7.5, 10mM
MgC12 and 5 units of T4 DNA ligase. This mix was incubated at 15 deg. centigrade for 20 hours after which the DNA was extracted with water saturated phenol and precipitated from ethyl alcohol. The DNA was subsequently resuspended in 50 microL. of water. Introduction of 1 microL of this DNA into E.coli by eletroporation resulted in approximately 3000-10,000 ampicillin resistant bacterial colonies.
2) Library of EcoRI fragments.
About 0.7 microg. of EcoRI digested DNA was purified and mixed with 0.45 micrograms of Bluescript SK+
plasmid which had been previously digested with EcoRI and treated with calf intestinal phosphatase. The fragments were ligated in 50 microL of solution. After purification and precipitation, t:he DNA was resuspended in 50 microL of water. Electroporation of E. coli with 1 microL of this solution resultedin approximately 200 ampicillin resistant bacterial colonies.
In order to identify suitable restriction fragments from the genome for further cloning, the plasmid was uniformly labeled with 32p and used as a probe to analyze DNA froin the strain CCUG digested with various restriction enzymes, separated on agarose gel *trade-mark SUBSTITUTE SHEET

electrophoresis and transferred to nitrocellulose filter.
The probe revealed a unique approximately 3.5kb HindIII
restriction fragment. A library of HindIII digested DNA
fragments was prepared and cloned in the Bluescript plasmid vector. This library was screened with 32p labeled DNA
corresponding to the 87 bp fragment previously cloned. Two clones containincl identical approximately 3.3 kbp hindIiI
fragments were identified. DNA sequencing of these HindIII
fragments revealed sequences capable of coding for the 23 amino acids corresponding to the amino terminus of the previously described 87 kDa cytotoxin. These sequences comprised part of an open reading frame of approximately 300 nucleotides which terminated at the extremity of the fragment delimited by a HindIII restriction site. The sequence also revealed the existence of an EcoRI restriction site within the utative open reading frame 120 bp away from the HindIII site.
A 32p labeled probe corresponding to the sequences between the EcoR:C site and the HindIII site was used to screen a library of EcoR fragments from DNA cloned in the Bluescript SK vector. This probe revealed two clones containing approximately 7.3 kbp fragments. DNA sequencing of these fragments revealed a continuous open reading frame which overlapped with the sequences determined from the 3.2 kbp HindIII fragments. The DNA sequence of these overlapping fragments and the conceptual translation of the single long open reading frame contained are shown in Figs.
1 and 2, respectively.
It should be noted that these clones were found to be extremely unstable. The initial colonies identified in the screening were so small as to be difficult to detect.
Expansion of these clones by traditional methods of subculturing for 16-18 hours resulted in very heterogeneous populations of plasmids due to DNA rearrangement and deletion. Sufficient quantities of these clones were grown by subculturing for 8-10 hours in the absence of antibiotic selection. In this fashion, although yields of plasmid were relatively low, selection and outgrowth of bacteria containing viable rearranged plasmid were avoided.

SU3SifTUic SP-iE't=---F

c. Screening of DNA libraries The product of the PCR reaction which contained the predominant 87 bp fragment was labeled with 32p by the random priming method using the Prime-a-gene kit (Promega).
5 This labeled probe was used in a hybridization reaction with DNA from approximately 3000 bacterial clones immobilized on nitrocellulose filters. The hybridization reaction was carried out at 60 degrees centigrade in a solution of 0.3M
NaCl. A positive bacterial clone was expanded and plasmid 10 DNA was prepared. The plasmid contained an insert of approximately 3.3kb of DNA and was designated TOXHH1.
A 120 bp fragment containing the sequences between position 292 and 410 shown in Fig. 1 was derived from the plasmid TOXHH1 and used to screen approximately 400 colonies 15 of the library of EcoRI fragments. A positive clone was isolated which c:ontained approximately 7.3kb of DNA
sequences and was designated TOXEE1.
The nucleotide sequence shown in Fig. 1 was derived from the clones TOXHH1 and TOXEE1 using the 20 Sequenase 2 sequenc:ing kit. The nucleotides between position 1 and 410 in Fig. 1 were derived from TOXHHI and those between 291 and 3507 were derived from TOXEEI. E. coli containing plasmids TOXHHI and TOXEE1 have been-deposited with the American Type Culture Collection, see below.
25 d. Preparation of antisera against the cytotoxin A DNA fragment corresponding to nucleotides 116-413 of the sequence shown in Fig. 1 was cloned into the bacterial expression vector pex 34 A, such that on induction of the bacterial promoter, a fusion protein was produced 30 which contained a part of the MS2 polymerase polypeptide fused to the amino acids of the cytotoxin polypeptide and including the 23 amino acids previously identified.
Approximately 200 micrograms of this fusion protein were partially purified by.acrylamide gel electrophoresis and 35 used to immunize rabbits by standard procedures.
Antisera from these rabbits taken after 3 immunizations spaced 1 month apart was used to probe protein extracts from a cytotoxin positive and a cytotoxin negative strain of H. pvlori in standard immunoblotting experiments.
~~BSTi i Ui"E S"'Hd'Ex antisera revealed a polypeptide which migrated on denaturing polyacrylamide gel electrophoresis with an apparent molecular mass of 100 kDa. This polypeptide was detected in protein extracts of the cytotoxin positive but not the cytotoxin negative strain. Serum collected prior to immunization did not react.with this polypeptide.
e. Partial purification of vacuolating activity Total H. pylori membranes at a concentration of 6 mg/ml were solubilized in a solution of 1% CHAPS, 0.5 M
NaCl, 10 mM Hepes pH 7.4, 2.5 mM EDTA, 20% sucrose for 1 hour at 4 C. This mixture was then applied to a discontinuous sucrose gradient containing steps of 30%, 35%, 40% and 55% sucrose and subjected to ultracentrifugation for 17 hours at 20000 x g. The gradient was fractionated and each fraction was tested for vacuolating activity and for urease activity. Vacuolating activity associated with urease activity was found in several fractions of the gradient. A
peak of vacuolating activity was also found in the topmost fractions of the gradient and these fractions were essentially free of urease activity.
This urease-independent vacuolating activity was further fractionated by stepwise precipitation with ammonium sulphate between concentrations of 20% to 34%.-Denaturing polyacrylamide gel electrophoresis of the proteins precipitated at different concentrations of ammonium sulphate revealed a predominant polypeptide of about 100 kDa which copurified with the vacuolating activity. This polypeptide was recognised by the rabbit antisera raised against the recombinant fusion protein described above.
2. Results Two overlapping fragments corresponding to about 10 kbp of the H. pylori genome have been cloned. These clones contain a gene consisting of 3960 bp (shown in Fig.1) which is capable of coding for a polypeptide of 1296 amino acids (shown in Fig.2). The molecular weight of this putative polypeptide is 139.8 kd. The nucleotide sequence AGGAAG 9 bp upstream of the methionine codon at position 18 in Fig.1 resembles closely the consensus Shine-Dalgarno sequence and supports the hypothesis that this methionine SUBSTITUTE SHEEE i WO 93/18150 21317c~ 9 PCT/EP93/00472 47 ~

represents the initiator methionine for synthesis of the polypeptide. A 30 bp nucleotide sequence which begins 10 bp downstream of the putative stop codon at position 3906 in Fig. 1 resembles closely the the structure of prokaryotic transcription terminators and is likely to represent the end of the messenger RNA coding sequences.
The cytotoxin gene is defined as coding for a polypeptide precursor of the H. pylori vacuolating activity by the following criteria:
(i) The putative polypeptide contains the 23 amino acid sequence (Fig. 2, positions 34-56) identified as the amino terminus of the previously described 87 kDa vaculating protein, Clover et al., J. Biol. Chem. 267:10570-75 (1992). This sequence is preceded by 33 amino acids which resemble prokaryotic leader sequences; thus, this sequence is likely to represent the amino terminus of a mature protein;
(ii) Rabbit antisera specific for a 100 amino acid fragment of the putative polypeptide containing the proposed amino terminus recognized a 100 kDa polypeptide in a cytotoxin positive but not a cytotoxin negative strain of H. ipylori. This 100 kDa polypeptide copurifies with vacuolating activity from H. pylori membranes.
In sum, the gene described herein codes for an approximately 140 kDa polypeptide which is processed to a 100 kDa polypeptide involved in H. Aylori cytotoxic activity. The 87 kDa polypeptide previously described must result.from either further processing of the 100 kDa polypetide or from proteolytic degradation during purif ication .
ii. H. pylor:i CAI antiqen 1. Materials and rnethods a. Origin of materials Clones Al, 64/4, G5, A17, 24 and 57/D were obtained from the lambda gtll library. Clone B1 was obtained from a genomic plasinid library of HindIiI fragments. 007 was obtained by PCR. The H. Qylori strains producing the cytotoxin were: G10, G27, G29, G32, G33, G39, G56, G65, G105, G113A. The noncytotoxic strains were: G12, G21, G25, SUBSTITUTE SHEET

WO 93/181~0 PGT/EP93/00472 G47, G50, G204. They were isolated from endoscopy biopsy specimens at the Grosseto Hospital, (Tuscany, Italy). The strain CCUG 17874 (cytotoxin positive), was obtained from the Culture Collection of the University of Gotheborg. The noncytotoxic strains Pylo 2U+ (urease positive) and Pylo 2U-(urease negative) were obtained from F. Megraud, Centre Hospitalier, Bordeaux (France). E. coli strains DH10B
(Bethesda Research Laboratories), TG1, K12 delta Hi delta trp, Y1088, Y1089, Y1090 are known in the art. Plasmid Bluescript SK+ (Stratagene, La Jolla, CA) was used as a cloning vector. The pEx34 a, b, c plasmids for the expression of MS2 fusion proteins have been previously described. The lambda gtll phage vector used for the expression library is from the lambda gt11 cloning system kit (Bethesda Research Laboratories). E. coli strains were cultured in LB medium (24). H. pylori strains were plated onto selective media (5% horse blood, Columbia agar base with Dent or Skirrow's antibiotic supplement, 0.2%
cyclodextrin) or in Brucella broth liquid medium containing 5% fetal bovine serum (6) or 0.2% cyclodextrin (25).
b. Growth of H. pylori and DNA isolation H. pylori strains were cultured, in solid or liquid media for 3 days at 37 C, both in microaerophilic atmosphere using Oxoid (Basingstoke, England) or Becton and Dickinson (Cockeysville, MD) gas pack generators or in an incubator containing air supplemented with 5% C02, (26). The bacteria were harvested and resuspended in STE (NaCl 0.1M, Tris-HC1 lOmM pH 8, EDTA 1 mM pH 8) containing lysozyme at a final concentration of 100 micrograms/ml and incubated at room temperature for 5 min. To lyse the bacteria SDS was added to a final concentration 1% and heated at 65 C. After the addition of proteinase K at final concentration of 25 micrograms/ml the solution was incubated at 50 for 2 hours.
The DNA was purified by CsCl gradient in the presence of ethidium bromide, precipitated with 77% ethanol and recovered with a sealed glass capillary.
c. Construction and screening of a lambda gt11 expression library To generate the lambda gtll expression library, SUBSTITUTE SHE= k genomic DNA from the CCUG 17874 strain partially digested with the restriction enzymes HaeIII and Alul was used. After fractionation on 0.8% agarose gel, the DNA between 0.6 and 8 Kb in size was eluted using a Costar Spin-X*(0.22 micron) microcentrifuge filter. The produdts from each digestion were combined, and used to construct the-expression library, ~
using the lambda gtll cloning system kit (Bethesda Research Laboratories) and. the Gigapack II Gold*packaging kit (Stratagene, La Jolla, CA). The library that contained 0.8-1 x 106 recombinant phages was amplified in E. coli Y1088, obtaining 150 ml of a lysate with a t#,'Pr of 109 phages/ml, 85% of which were recombinant and had an average insert size of 900 base pairs, õ Immunological screening was performed by standard procedures, using the Protoblot system (Promega, Madison, WI).
d. Construction of plasmid libraries Attempts to make complete genomic libraries of partially digested chromosomal DNA, using standard vectors such as EMBL4 or lambda Dash encountered the difficulties described also by many authors in cloning H. pylori DNA and failed to give satisfactory libraries. Therefore,.partial libraries were obtained using genomic DNA,from strains CCUG
17874, G39 and G50 digested with the restriction enzyme HindiIl, cloned in the Bluescript SK+. DNA ligation, electroporation of E. coli DH lOB, screening, and library amplification have been performed. Libraries ranging from 70000 to 85000 colonies with a background not exceeding the 10% were obtained., e. DNA manipulation and nucleotide sequencing DNA manipulation was performed using standard procedures. DNA seiquencing was performed using Sequenase 2.0 (USB) and the DNA fragments shown in Fig. 3 subcloned in Bluscript KS+. Each strand was sequenced at least three times. The region between nucleotides 1533 and 2289, for which a DNA clone was not available, was amplified by PCR
and sequenced using asymmetric PCR, and direct sequencing of amplified products. The overlapping of this region, was confirmed by one and double side anchored PCR: an external universal anchor (5'-GCAAGCTTATCGATGTCGACTCGAGCT-31/ 5'-*trade-mark SUBSTiTUTc SHB~

WO 93/18150 PCT/Et'y3iuu/

GACTCGAGTCGACATCGA-3') containing a protruding 5' HindIII
sequence, and the recognition sites of C1aI, SalI, XhoI, was ligated to primer-extended DNA and amplified. A second round of PCR using nested primers was then used to obtain fragments of DNA suitable for c,~;oziling and sequencing. DNA
sequence data were assembled and analyzed with the GCG*
package (Genetics Computer Group, Inc., Madison, WI) running on a VAX 3900 under VMS. The GenBank and EMBL databases were examined using the EMBL VAXcluster.
f. Protein preparation and ELISA
Protein extracts were obtained by treating H.
.-~
pylori pellets with 6 M guanidine. Western.;blotting, SDS-PAGE, electroelution were performed by standard procedures.
Fusion proteins were induced and purified by electrocution or by ion exchange chromatography. Purified proteins were used to immunize rabbits and to coat microtiter plates for ELISA assays. Sera from people with normal mucosa, blood donors and patie:nts were obtained from A. Ponzetto (Torino, Italy) Clinical diagnosis was based on histology of gastric biopsies. Vacuolating activity of samples was tested on HeLa cells as described by Cover et al. Infect. Immun. 59:1264-70 (1991).
2. Results a. Immunodominance and cytotoxicity Western blots of H. pvlori guanidine extracts probed with sera from patients with gastroduodenal disease showed that a pr.otein of 130 kDa that is a minor component in the Coomassie blue stained gel was strongly recognized by all sera tested. The CAI protein was electroeluted and used to raise a mouse serum that in a Western blot recognized only this protein. This serum was then used to detect by Western blottir.ig the CAI protein in extracts of the H.
pylori strains. The antigen was present in the all 10 strains that had vacuolizing activity on HeLa cells while it was absent 'in the eight strains that did not have such activity; in addition, the size of the protein varied slightly among the strains. The CAI antigen was not detected by western blotting in the other species tested such as Campylobacter ;Leiuni, Helicobacter mustelae, E. coli, and 5'~ ~
*trade-mark StJBSTfTUTE SHEc WO 93/18150 2131729 PCr/EP93/00472 Bordetella pertussis.
b. Structure of the cai gene 106 cloiies of the lambda gtil expression library were screened using the mouse serum specific for the CAI
antigen and with a pool of sera from patients with gastroduodenal diseases. The mouse serum detected positive clones at a frequency of 3 x 10"3. Sequence analysis of 8 clones revealed that they were all partially overlapping with clone Al shown in Fig. 3. The pool of human sera identified many clones containing different regions of the cai gene, including clones 57/D, 64/4 and 24 and several clones overlapping clone Al.
In Fig. 3, clones Al, 64/4, G5, A17, 24, and 57/D
were obtained from the lambda gtll library. Clone B1 was obtained from a plasmid library of HindiII fragments. E.
coli containing plasmids 57/D, 64/4, B1 (B/i), and P1-24 (the latter most plasmid from nucleotide 2150 to 2650) have been deposited with the American Type Culture Collection (ATCC), see below. 007 was obtained by PCR. The open-reading frame is shown at the bottom of Fig. 3. Arrows indicate the position and direction of the synthetic oligonucleotides used as primers for sequencing, and the position of insertion of the repeated sequencefof G39 is shown. The nucleotide and amino acid sequence of one of the repeated sequences found in strain G39 is also shown. The capital letters indicate the sequences Dl, D2, and D3 duplicated from the cai gene, the small letters indicate the nucleotide and amino acid linkers, P=promoter, and T=terminator.
The nucleotide sequence of the entire region was determined using t:he clones derived from the lambda gtil library, the clone B1 isolated from the HindIII plasmid library, and the fragment 007 that was obtained by PCR of the chromosomal DNA. Computer analysis of the 5925 nucleotide sequence revealed a long open reading frame spanning nucleotides 535 to 3977 that was in frame with the fusion proteins dei-iving from the lambda gtil clones 64/4, 24 and Al and A17. Clone 57/D contained an open reading frame only in the 3' end of cloned fragment and therefore ~
SUBST(TUTE SHEE

WO 93/18150 PCT/EP93/004, could not make a gene fusion with the beta galactosidase gene of lambda gtll. The presence of an immunoreactive protein in the lambda gtll clone 57/D could only be explained by the presence of an.endogenous promoter driving ~,,.
the expression of a non fused pr~ot~e'in.. This hypothesis was proven to be true by subcloning in both -direction the insert 57/4 into the Bluescript plasmid vector and showing that an immunoreactive protein was obtained in both cases. A
conclusive. evidence that the gene identified was indeed coding for the C:AI antigen was obtained by subcloning the inserts A17 and 64/4 in the pEx 34B plasmid vectors to obtain fusion proteins that were purified and used to immunize rabbits. The sera obtained, recognized specifically the CAI antigen band in cytotoxic H. Dylori strains.
The cal gene coded for a putative protein of 1147 amino acids, wit:h predicted molecular weight of 128012.73 Daltons and an isoelectric point of 9.72. The basic properties of the purified protein were confirmed by two dimensional gel electrophoresis. The codon usage and the GC
content (37%) of the gene were similar to that described for other H.pylori genes. A putative ribosome binding site: AGGAG, was identified 5 base pairs_upstream from the proposed ATG starting codon. Computer search for promoter sequences of the region upstream from the ATG start codon, identified sequences resembling either -10 or - 35 regions, however, a region with good consensus to an E. coli promoter, or r.esembling published_ H. py ori promoter sequences was riot found. Primer extension analysis of purified H. pylori RNA showed that 104 and 214 base pairs upstream from the ATG start codon there are two transcriptional start sites. Canonical promoters could not be identified upstream from either transcriptional initiation sites. The expression of a portion of the CAI
antigen by clone 57/D suggests that E. coli is also recognizing a promoter in this region, however, it is not clear whether E. coli recognizes the same promoters of H.
pylori or whetrLer the H. pYlori DNA that is rich in A-T
provides E. co i with regions that may act as promoters. A
rho independent terminator was identified downstream from c)UBSTITUTc SHEET

the stop codon. In Fig. 4, the AGGAG ribosome binding site and terminator are underlined, and the repeated sequence and motif containing 6 asparagines are boxed. The CAI antigen was very hydrophilic, and did not show obvious leader peptide or transmembrane sequences. The most hydrophilic region was from amino acids 600 to 900, where also a number of unusual features can be observed: the repetition of the sequences EFKNGKNKDFSK and EPIYA, and the presence of a streatch of six contiguous asparagines (boxed in Fig. 4).
c. Diversity of the cai gene Diversity of the gene appears to be generated by internal duplications. To find out the mechanism of size hete:rogeneity of the CAI proteins in different strains, the structure of one of the strains with a larger CAI protein (G39) was analyzed using Southern blotting, PCR and DNA
sequencing. The results showed that the cai gene of G39 and CCUG 17874 were identical in size until position 3406, where the G39 strain was found to contain an insertion of 204 base pairs, made by two identical repeats of 102 base pairs.
EactYi repeat was found to contain sequences deriving from the duplication of 3 seginents of DNA (sequences Dl, D2 and D3 in Fig. 3) coming from the same region of the cai gene and conriected by small linker sequences. A=schematic representation of the region where the insertion occurred and of the insertion itself is shown in Fig. 3.
d. cai gene absent in noncytotoxic strains To investigate why the CAI antigen was absent in the noncytotoxic strains, DNA from two of them (G50 and G21), was digested with EcoRI, HindIII and HaeIII
restriction enzymes, and tested by Southern blotting using two probes internal to the cai gene, spanning nucleotides 520--1840 and 2850-4331 respectively. Both probes recognized strongly hybridizing bands in strains CCUG 17874 and G39.
The bands varied in size in the two strains, in agreement with the gene diversity. However, neither probe hybridized the G50 and G21 DNA. This showed that the noncytotoxic strains tested do not contain the cai gene.
e. Serum antibodies The presence of serum antibodies against the CAI

antigen correlated with gastroduodenal diseases. To study the quantitative antibody response to the CAI antigen, the fusion protein produced by the A17 fragment subcloned in pEx34 was purified to homogeneity and used to coat microtiter plates for an ELISA test. In this assay, the patients with gastroduodenal pathologies had an average ELISA titer that was significantly higher than that found in randomly selected blood donors and people with normal gastric mucosa. To evaluate whether the antibody titer correlated with a particular gastroduodenal disease, the sera from patients with known histological diagnosis were tested in the ELISA assay. Patients with duodenal ulcer had an average antibody titer significantly higher than all the other diseases. Altogether, the ELISA was found to be able to predict 75.3% of the patients with any gastroduodenal disease and 100% of the patients with duodenal ulcer.
In one particular ELISA, a recombinant protein containing 230 amino acids deriving from CAI antigen was identified by screening an expression library of H. pylori DNA using an antiserum specific for the protein. The recombinant antigen was expressed as a fusion protein in E.
coli, purified to homogeneity, and used to coat microtiter plates. The plates were then incubated for 90 minutes with a 1/2000 dilution of goat anti-human IgG alkaline phosphatase cojugate. Following washing, the enzyme substrate was added to the plates and the optical density at 405 nm was read 30 minutes later. The cutoff level was determined by the mean absorbance plus two standard deviations, using sera from 20 individuals that had neither gastric disease nor detectable anti-H. pylori antibodies in Western blotting. The ELISA assay was tested on the peripheral blood samples of eighty-two dyspeptic patients (mean age 50.6 13.4 years, ranging from 28 to 80) undergoing routine upper gastrointestinal endoscopy examination. The gastric antral mucosa of patients was obtained for histology and Giemsa strain. Twenty of the patients had duodenal ulcer, 5 had gastric ulcer, 43 had chronic active gastritis type B, 8 had duodenitis and 6 had a normal histology of gastric mucosa. All of the patients with duodenal ulcer had SUBSTITUTE SKEET

WO 93/18150 2131729 PC'T,/EP93/00472 an optical density value above the cutoff level. The patients with duodenitis, gastric ulcer, and chronic gastritis, had a positive ELISA value in 75%, 80% and 53.9%
of the cases, respectively. The agreement between ELISA and 5 histological Giemsa staining was 95% in duodenal ulcer, 98%
in duodenitis, 80% in gastric ulcer and 55.8% in chronic gastritis. This assay gives an excellent correlation with duodenal ulcer disease (pt0.0005) .
iii. Heat shock protein (hsp) 10 1. Materials and methods a. H. pylori strains and growth conditions H. pylori strains used were: CCUG 17874, G39 and G33 (isolated from gastric biopsies in the hospital of Grosseto, Italy), Pylo 2U+ and Pylo 2U- (provided by F.
15 Megraud, hospital. Pellegzin, Bordeaux, France), BA96 (isolated by gastric biopsies at the University of Siena, Italy) . Strain Pylo 2U+ is noncytotoxic; strain Pylo 2U- is noncytotoxic and urease-negative. All strains were routinely grown on Columbia agar containing 0.2% of 20 cyclodextrin, 5 g/ml of cefsulodin and 5 g/ml of amphotericin B under microaerophilic conditions for 5-6 days at 37~C . Cells were harvested and washed with PBS. The pellets were resuspended in Laemmli sample buffer.and lysed by boiling.
25 Sera of patients affected by gastritis and ulcers (provided by A. Ponzetto, hospital "Le Molinette", Torino, Italy) and sera of patients with gastric carcinoma (provided by F. Roviello, University of Siena, Italy) were used.
b. Immunoscr-eeninq of the library 30 Five hundred thousand plaques of a Xgt11 H. pvlori DNA expression libr=ary were mixed with 5 ml of a suspension of E. coli strain Y1090 grown O/N in LB with 0.2% Maltose and l OmM MgSO4 , and resuspended in 10mM MgSO4 at 0.5 O. D.
After 10 minutes incubation at 37 C, 75 ml of melted 35 TopAgarose were poured in the bacterial/phage mix and the whole was plated on BBL plates (50,000 plaques/plate).
After 3.5 hrs incubation of the plated library at 42 C, nitrocellulose fil'ters (Schleicher and Schuell, Dassel, Germany), previously wet with lOmM IPTG, were set on plates SUBS T ITUTE S~~P-T

WO 93/18150 PCF/EP93/01' and incubation was prolonged for 3.5 hrs at 37 C and then OJN at 4 C. Lifted filters with lambda proteins were rinse in PBS, and saturated in 5% nonfat dried milk dissolved in TBST (10mM TRIS pH 8, 100mM NaCl, 5M MgC12) for 201. The first hybridization step was p,qpformed with the sera of patients; to develop and visualize positive plaques we used an anti human Ig antibody alkaline phosphatase conjugated (Cappel, West Chester, PA) and the NBT/BCIP kit (Promega, Madison, WI) in AP buffer (100mM Tris pH-9.5, 100mM NaCl, 5mM MgC12) according to the manufacturer instructions.
c. Recombinant DNA procedures Reager3ts and restriction enzymes used were from Sigma (St. Louis, MO) and Boehringer (Mannheim, Germany).
Standard techniques were used for molecular cloning, single-stranded DNA purification, transformation in E. coli, radioactive labeling of probes, colony screening of the H.
pylori DNA genomic library, Southern blot analysis, PAGE and Western blot analysis.
d. DNA sequence analysis The DNA fragments were subcloned in Bluescript SK+
(Stratagene, San Diego, CA). Single-stranded DNA sequencing was performed by using [33P]adATP (New England Nuclear, Boston, MA) and the Sequenase kit (U.S. Biochemical Corp., Cleveland, OH) according to the manufacturer instructions.
The sequence was determined in both strands and each strand was sequenced, on average, twice. Computer sequence analysis was performed using the GCG package.
e. Recombinant proteins MS2 polymerase fusion proteins were produced using the vector pEX34A, a derivative of pEX31. Insert Hp67 (from nucleotide 445 to nucleotide 1402 in Fig. 5), and the EcoRI
linkers were cloned in frame into the EcoRi site of the vector. In orcter to confirm the location of the stop codon, the HpG3' HindIII fragment was cloned in frame into the HindIIl site of pEX34A. Recombinant plasmids were transformed in E. coli K12 ;H1 Atrp. In both cases after induction, a fusion protein of the expected molecular weight wasproduced. In the case of the EcoRI/EcoRI fragment, the fusion proteir- obtain after induction was electroeluted to *trade-mark SUBSTtTUTE SHEET

WO 93/18150 PC'T/EP93/00472 21317?9 immunize rabbits using standard protocols.
2. Results a. Screening of an expression library and cloning of H.
pylori hsp In order to find a serum suitable for the screening of an H. pylori DNA expression library, sonicated extracts of H. p lori strain CCUG 17874 were tested in Western blot analysis against sera of patients affected by different forms of gastritis. The pattern of antigen recognition by different sera was variable, probably due to differences in thE: individual immune response as well as to the differences in the antigens expressed by the strains involved in the infection.
Serum N 19 was selected to screen a a.gtil H.
pvlori DNA expression library to identify H. uvlori specific antigens, expressed in vivo during bacterial growth.
Following screeni,ng of the library with this serum, many positive clones were isolated and characterized. The nucleotide sequence of one of these, called Hp67, revealed an open-reading frame of 958 base-pairs, coding for a protein with high homology to the hsp60 family of heat-shock proteins, Ellis, Nature 358:191-92 (1992). In order to obtain the entire coding region, we used fragment Hp67 as a probe on Southern blot analysis of H. pylori DNAVdigested with different restriction enzymes. Probe Hp67 recognized two HindIiI bands of approximately 800 and 1000 base-pairs, respectively. A genomic H. pylori library of HindIiI-digested DNA was screened with probe Hp67 and two positive clones (HpG5) and HpG3') of the expected molecular weight were obtained. E. coli containing plasmids pHp60G2 (approximately nucleotides 1 to 829) and pHp60G5 (approximately nucleotides 824 to 1838) were deposited with the American Type Culture Collection (ATCC).
b. Sequence analysis The riucleotide sequence analysis revealed an open-reading frame of IL638 base-pairs, with a putative ribosome binding site 6 base-pairs upstream the starting ATG. Fig.
5 shows the nucleotide and amino acid sequences of H. pylori hsp. The putative ribosome-binding and the internal HindIII
SUBSTITUTE SH EEET

site are underlined. Cytosine in position 445 and guanine in position 1402 are the first and last nucleotide, respectively, in fragment Hp67. Thymine 1772 was identified as the last putative nucleotide transcribed using an algorithm for the localization of factor-independent terminator regions. Theopen-reading frame encoded for a protein of 546 amino acids, with a predicted molecular weight of 58.3 KDa and a predicted pI of 5.37. The codon preference of this gene is in agreement with the H. gylori codon usage.
The analysis of the hydrophylicity profiles revealed a protein mostly hydrophilic, without a predicted leader peptide or other transmembrane domains. The amino terminal sequence showed 100% homology to the sequence of 30 amino acids determined by Dunn et al., Infect. Immun.
60:1946-51 (1992) on the purified protein and differed by only on reside (Ser42 instead of Lys) from the sequence of 44 amino acids published by Evans et al, Infect. Immun.
60:2125-27 (1992). (Evans et al., 1992). The N-terminal sequence of the mature hsp protein did not contain the starting methionine, indicating that this had been removed after translation.
c. Homology with hsp60 family The amino acid sequence analysis showed a very strong homology with the family of heat-shock proteins hsp60, whose members are present in every living organism.
Based on the degree of homology between hsp60 proteins of different species, H. pylori hsp belongs to the subgroup of hsp60 proteins of Gram negative bacteria; however, the degree of homology to the other proteins of the hsp60 family is very high (at least 54% identity).
d. Expression of recombinant proteins and production of a polyclonal antiserum The inserts of clone Hp67 and of clone HpG3' were subcloned in the expression vector pEX34A in order to express these open-reading frames fused to the aminoterminus of the MS2 polymerase. The clones produced recombinant proteins of the expected size and were recognized by the human serum used for the initial screening. The fused SUBSTITUTE SHEET

WO 93/18150 21317rl 9 PCT/EP93/00472 protein derived from clone Hp67 was electroeluted and used to immunize rabbits in order to obtain anti-hsp specific polyclonal antisera. The antiserum obtained recognized both fusion proteins, and a protein of 58 KDa on whole-cell extracts of several strains of H. pylori tested, including a urease-negative strain and noncytotoxic strains.
Hsp has been shown to be expressed by all the H.
pvlori strains tested and its expression is not associated with the presence of the urease or with the cytotoxicity.
The protein recogriized by the anti-hsp antiserum was found in the water soluble extracts of H. pylori and copurified with the urease subunits. This suggests a weak association of this protein with the outer bacterial membrane. Thus, hsp can be described as urease-associated and surface exposed. The cellular surface localization is surprising as most of the hsp homologous proteins are localized in the cytoplasm or in mitochondria and plastids. The absence of a leader peptide in hsp suggests that this is either exported to the membrane by a peculiar export system, or that the protein is released from the cytoplasm and is passively adsorbed by the bacterial membrane after death of the bacterium.
Hsp60 proteins have been shown to act as- molecular chaperons assisting the correct folding, assembly and translocation of either oligomeric or multimeric proteins.
The cellular loca:lization of H. pylori hsp and its weak association with urease suggest that hsp may play a role in assisting the folding and/or assembly of proteins exposed on the membrane-surface and composed of multiple subunits such as the urease, whose final quaternary structure is A6B6.
Austin et al., J. Bacteriol. 174:7470-73 (1992) showed that the H. pylori hsp ultrastructure is composed of seven subunits assembled in a disk-shaped particle that further stack side by side in groups of four. This structure resembles the shape and dimension of the urease macromolecule and this could explain the common properties of these two macromolecules that lead to their copurification. H. pylori hsp gene, however, is not part of the urease operon. In agreement with the gene structure of SUBSTITUTE SHEET

WO 931-1~150 PCT/EP93/00472 1,~ ~

other bacterial hsp60 proteins, it should be part of a dicistronic operon.
e. Presence of anti-hsp antibodies in patients with gastroduodenal diseases 5 The purified fusion protein was tested by Western blot using sera of patients infected by H. p lori and affected by atrophic and superficial gastritis, and patients with duodenal and gastric ulcers: most of the sera recognized the recombinant protein. However, the degree of 10 recognition greatly varied between different individuals and the antibody levels did not show any obvious correlation with the type of disease. In addition, antibodies against H. pylori antigens and in particular against hsp protein were found in most of the 12 sera of patients affected by 15 gastric carcinoma that were tested. Although H. plori hsp recognition could not be put in relation with a particular clinical state of the disease given the high conservation between H. pylori hsp and its human homolog, it is possible that this protein may induce autoimmune antibodies cross-20 reacting with the human counterpart. This class of homologous proteins has been implicated in the induction of autoimmune disorders in different systems. Thenpresent of high titers of anti-H. Pylor hsp antibodies, protentially cross-reacting with the human homolog in dispeptic patients, 25 suggests that this protein has a role in gastroduodenal disease. This autoreactivity could play a role in the tissue damage that occurs in H. pylori-induced gastritis, thus increasing the pathogenic mechanisms involved in the infection of this bacterium.
30 The high levels of antibodies against such a conserved protein is somewhat unusual; due to the high homology between members of the hsp60 family, including the human one, this protein should be very well tolerated by the host immune system. The strong immune response observed in 35 many patients may be explained in two different ways: (1) the immune response is directed only against epitopes specific for H. pylori hsp; (2) the immune response is directed against epitopes which are in common between H.
pylori hsp and human homolog.

SUBSTITUTE SHEET

Deposit of Biolo~oical Materials The following materials were deposited on December 15, 1992 and January 22, 1993 by Biocine Sclavo, S.p.A., the assignee of the present invention, with the American Type Culture Collection (ATCC), 12301 Parklawn Drive, Rockville, Maryland, phone (301) 231-5519, under the terms of the Budapest Treaty on the International Recognition of the Deposit of Microorganisms for Purposes of Patent Procedure.
For the cytotoxin priotein (CT):
ATCC No. 69157 E. c2li TG1 containing the plasmid TOXHH1 ATCC No. n/a E. cgli. TG1 containing the plasmid TOXEEl For the CAI protein:
ATCC No. 69158 E. coli TG1 containing the plasmid 57/D
ATCC No. 69159 E. co,~', TG1 containing the plasmid 64/4 ATCC No. 69160 E. col,.i, TG1 containing the plasmid P1-24 ATCC No. 69161 E. c,gli TG1 containing the plasmid B/1 For the heat shock protein (hsp):
ATCC No. 69155 E. coli TG1 containing the plasmid pHp6OG2 ATCC No. 69156 E. cgli, TG1 containing the plasmid pHp605 These deposits are provided as convenience to those of skillin the art. A license may be required to make, use, or sell the deposited materials, and no such license iis granted hereby.

Claims (22)

CLAIMS:
1. A protein consisting of:
(a) a Helicobacter pylori cytotoxin associated immunodominant antigen having the amino acid sequence shown in Figure 4;
(b) a Helicobacter pylori cytotoxin associated immunodominant antigen having the amino acid sequence shown in Figure 4 modified by one or more conservative amino acid substitutions that do not substantially affect antigen function;
(c) a protein which can be immunologically identified by an antibody which reacts specifically with the Helicobacter pylori cytotoxin associated immunodominant antigen of (a);
(d) a Helicobacter pylori cytotoxin associated immunodominant antigen comprising two repeats of amino acid sequence GRSVSPEPIYATIDDLGGPFPLKRHDKVDDLSKV;
(e) a protein comprising a fragment of the amino acid sequence shown in Figure 4, wherein said fragment is a portion of at least 11 amino acids from said sequence; and (f) the protein of (b), (c), (d) or (e), comprising amino acid sequence EFKNGKNKDFSK;
(g) the protein of (b), (c), (d) or (e), comprising amino acid sequence EPIYA; or (h) the protein of (b), (c), (d) or (e), comprising amino acid sequence NNNNNN.
2. The protein of claim 1, which is labelled or coupled to a sold support.
3. The protein of claim 1 or claim 2 for use in the treatment of Helicobacter pylori infection.
4. The protein of claim 1 or claim 2 for use as a vaccine.
5. A vaccine or therapeutic composition comprising the protein of claim 1 or claim 2 and a pharmaceutically acceptable carrier.
6. The vaccine or therapeutic composition of claim 5 further comprising one or more of:
i) a Helicobacter pylori cytotoxin protein or precursor thereof;
ii) a recombinant Helicobacter pylori heat shock protein;
iii) a Helicobacter pylori urease.
7. The vaccine or therapeutic composition of claim 5 or claim 6, further comprising an adjuvant.
8. A method for the preparation of a vaccine or therapeutic composition according to any one of claims 5 to 7 comprising bringing one or more proteins according to claim 1 or claim 2 into association with a pharmaceutically acceptable carrier and, optionally, an adjuvant.
9. An in vitro immunodiagnostic assay to detect presence or absence of Helicobacter pylori antibodies comprising reacting, as at least one binding partner, a protein according to claim 1 or 2 with a sample suspected to contain said Helicobacter pylori antibodies, a detected positive reaction being taken as indicative of the presence of said Helicobacter pylori antibodies in said sample.
10. An immunodiagnosis kit for performing an assay according to claim 9, comprising at least one protein according to claim 1 or claim 2 in association with instructions for performing said assay.
11. Use of one or more protein(s) according to claim 1 or claim 2 in the manufacture of a medicament for the treatment or prevention of Helicobacter pylori infection.
12. A polynucleotide which encodes a protein according to claim 1.
13. A polynucleotide of claim 12, comprising all of the nucleotide sequence of Figure 4 or a part thereof which encodes at least 11 amino acids of the amino acid sequence of Figure 4.
14. A polynucleotide probe comprising at least 8 contiguous nucleotides of (a) the polynucleotide of claim 12 or claim 13, or (b) the complement of (a).
15. The probe of claim 14, comprising at least 14 contiguous nucleotides of (a) or (b).
16. A nucleic acid assay to detect presence or absence of Helicobacter pylori comprising reacting a probe according to claim 14 or 15 with a sample suspected to contain Helicobacter pylori, a detected positive reaction being taken as indicative of the presence of said Helicobacter pylori in said sample.
17. A kit for preforming a nucleic acid assay according to claim 16, comprising at least one polynucleotide probe according to claim 14 or claim 15 in association with instructions for performing said assay.
18. Use of a polynucleotide comprising at least 14 contiguous nucleotides of (a) the polynucleotide of claim 12 or claim 13, or (b) the complement of (a) as a polynucleotide primer in polynucleotide amplification.
19. A kit for performing polynucleotide amplification employing a polynucleotide primer wherein said kit comprises at least one polynucleotide primer comprising at least 14 contiguous nucleotides of (a) the polynucleotide of claim 12 or claim 13, or (b) the complement of (a) in association with instructions for use in said polynucleotide amplification.
20. A vector comprising a recombinant polynucleotide of claim 12 or claim 13.
21. A host cell transformed with a vector according to claim 20.
22. A method for the production of a recombinant polypeptide according to claim 1 or claim 2, comprising culturing a host cell according to claim 21 and isolating the recombinant polypeptide.
CA002131729A 1992-03-02 1993-03-02 Helicobacter pylori proteins useful for vaccines and diagnostics Expired - Lifetime CA2131729C (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
CA002383007A CA2383007A1 (en) 1992-03-02 1993-03-02 Helicobacter pylori proteins useful for vaccines and diagnostics

Applications Claiming Priority (5)

Application Number Priority Date Filing Date Title
ITFI920052A IT1262895B (en) 1992-03-02 1992-03-02 Protein extracted from cytotoxic strains of Helicobacter pylori, gene expressing it, use of the protein as a vaccine or for diagnostic purposes.
ITFI92A000052 1992-03-02
EPPCT/EP93/00158 1993-01-25
WOPCT/EP93/00158 1993-01-25
PCT/EP1993/000472 WO1993018150A1 (en) 1992-03-02 1993-03-02 Helicobacter pylori proteins useful for vaccines and diagnostics

Related Child Applications (1)

Application Number Title Priority Date Filing Date
CA002383007A Division CA2383007A1 (en) 1992-03-02 1993-03-02 Helicobacter pylori proteins useful for vaccines and diagnostics

Publications (2)

Publication Number Publication Date
CA2131729A1 CA2131729A1 (en) 1993-09-16
CA2131729C true CA2131729C (en) 2008-02-12

Family

ID=26069992

Family Applications (2)

Application Number Title Priority Date Filing Date
CA002383007A Pending CA2383007A1 (en) 1992-03-02 1993-03-02 Helicobacter pylori proteins useful for vaccines and diagnostics
CA002131729A Expired - Lifetime CA2131729C (en) 1992-03-02 1993-03-02 Helicobacter pylori proteins useful for vaccines and diagnostics

Family Applications Before (1)

Application Number Title Priority Date Filing Date
CA002383007A Pending CA2383007A1 (en) 1992-03-02 1993-03-02 Helicobacter pylori proteins useful for vaccines and diagnostics

Country Status (7)

Country Link
US (3) US6077706A (en)
EP (1) EP0967279B1 (en)
JP (4) JP3368902B2 (en)
AU (1) AU3630093A (en)
CA (2) CA2383007A1 (en)
DE (2) DE69334197T2 (en)
WO (1) WO1993018150A1 (en)

Families Citing this family (92)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5866375A (en) * 1991-10-31 1999-02-02 Chiron S.P.A. Method for the culture of microorganisms of the genera helicobacter, campylobacter and arcobacter employing culture media comprising cyclodextrins
EP0629132B1 (en) * 1992-02-26 2004-08-11 Vanderbilt University Purified vacuolating toxin from helicobacter pylori and methods to use same
US5721349A (en) * 1992-02-26 1998-02-24 Vanderbilt University Vacuolating toxin-deficient H. pylori
US5928865A (en) * 1992-03-02 1999-07-27 Chiron S.P.A. Compositions comprising isolated Helicobacter pylori CagI polynucleotides and method of preparation thereof
IT1262896B (en) * 1992-03-06 1996-07-22 CONJUGATE COMPOUNDS FORMED FROM HEAT SHOCK PROTEIN (HSP) AND OLIGO-POLY-SACCHARIDES, THEIR USE FOR THE PRODUCTION OF VACCINES.
MX9301706A (en) * 1992-04-13 1994-05-31 Oravax Inc VACCINE COMPOSITION FOR THE TREATMENT OF HELICOBACTER INFECTION.
US5403924A (en) * 1992-10-13 1995-04-04 Vanderbilt University Taga gene and methods for detecting predisposition to peptic ulceration
US5733740A (en) * 1992-10-13 1998-03-31 Vanderbilt University Taga gene and methods for detecting predisposition to peptic ulceration and gastric carcinoma
US6290962B1 (en) * 1992-11-03 2001-09-18 Oravax, Inc. Urease-based vaccine and treatment for helicobacter infection
US5972336A (en) * 1992-11-03 1999-10-26 Oravax Merieux Co. Urease-based vaccine against helicobacter infection
US6258359B1 (en) 1993-05-19 2001-07-10 Institut Pasteur Immunogenic compositions against helicobacter infection, polypeptides for use in the compositions, and nucleic acid sequences encoding said polypeptides
WO1995014093A1 (en) * 1993-05-19 1995-05-26 Institut Pasteur Immunogenic compositions against helicobacter infection, polypeptides for use in the compositions and nucleic acid sequences encoding said polypeptides
GB9313279D0 (en) * 1993-06-28 1993-08-11 Medical Res Council Protection against infection with helicobacter pylori
US6406703B1 (en) 1993-07-27 2002-06-18 Csl Limited Treatment of H. pylori associated gastroduodenal disease
WO1995003824A1 (en) * 1993-07-27 1995-02-09 Csl Limited Treatment of h. pylori associated gastroduodenal disease
US5750119A (en) * 1994-01-13 1998-05-12 Mount Sinai School Of Medicine Of The City University Of New York Immunotherapeutic stress protein-peptide complexes against cancer
US5997873A (en) * 1994-01-13 1999-12-07 Mount Sinai School Of Medicine Of The City University Of New York Method of preparation of heat shock protein 70-peptide complexes
US5961979A (en) * 1994-03-16 1999-10-05 Mount Sinai School Of Medicine Of The City University Of New York Stress protein-peptide complexes as prophylactic and therapeutic vaccines against intracellular pathogens
GB2290710B (en) * 1994-06-29 1998-03-25 Reckitt & Colmann Prod Ltd Protease from helicobacter pylori for use in vaccines/therapeutic compositions
ATE229978T1 (en) * 1994-07-01 2003-01-15 Chiron Corp HELICOBACTER PROTEINS AND VACCINES
GB9505438D0 (en) * 1995-03-17 1995-05-03 Sod Conseils Rech Applic Antisense oligonucleotides
WO1997003359A1 (en) * 1995-07-07 1997-01-30 Oravax, Inc. Helicobacter clpb
US5935576A (en) 1995-09-13 1999-08-10 Fordham University Compositions and methods for the treatment and prevention of neoplastic diseases using heat shock proteins complexed with exogenous antigens
US5837251A (en) * 1995-09-13 1998-11-17 Fordham University Compositions and methods using complexes of heat shock proteins and antigenic molecules for the treatment and prevention of neoplastic diseases
US5985270A (en) * 1995-09-13 1999-11-16 Fordham University Adoptive immunotherapy using macrophages sensitized with heat shock protein-epitope complexes
WO1997013784A1 (en) * 1995-10-09 1997-04-17 Pasteur Merieux Serums Et Vaccins Helicobacter lactoferrin receptor
AU1463097A (en) * 1996-01-04 1997-08-01 Rican Limited Helicobacter pylori bacterioferritin
JPH1033179A (en) * 1996-07-24 1998-02-10 Fuso Yakuhin Kogyo Kk Probe for diagnosis of infectious disease
WO1998012562A1 (en) * 1996-09-20 1998-03-26 Cortecs International Limited Adhesins from heliobacter pylori and their diagnostic and therapeutic uses
PT946874E (en) * 1996-12-19 2002-10-31 Chiron Corp HELICOBACTER PYLORI DIAGNOSIS
US5830464A (en) * 1997-02-07 1998-11-03 Fordham University Compositions and methods for the treatment and growth inhibition of cancer using heat shock/stress protein-peptide complexes in combination with adoptive immunotherapy
US6017540A (en) 1997-02-07 2000-01-25 Fordham University Prevention and treatment of primary and metastatic neoplastic diseases and infectious diseases with heat shock/stress protein-peptide complexes
AU751433B2 (en) * 1997-04-30 2002-08-15 Merieux Oravax Anti-(helicobacter) vaccine composition for use by the subdiaphragmatic systemic route, and combined mucosal/parenteral immunization method
FR2748477B1 (en) * 1997-07-01 2001-07-13 Pasteur Merieux Serums Vacc NEW MEMBRANE PROTEIN OF HELICOBACTER PYLORI
US6914131B1 (en) 1998-10-09 2005-07-05 Chiron S.R.L. Neisserial antigens
EP1042480A1 (en) * 1997-12-31 2000-10-11 Stressgen Biotechnologies Corporation Streptococcal heat shock proteins of the hsp60 family
US6585975B1 (en) * 1998-04-30 2003-07-01 Acambis, Inc. Use of Salmonella vectors for vaccination against helicobacter infection
JP4346821B2 (en) * 1998-04-30 2009-10-21 カイロン ソチエタ ア レスポンサビリタ リミタータ H. Immunization and treatment against infection by Pylori
US6838553B1 (en) * 1999-10-05 2005-01-04 Academia Sinica Peptide repeat immunogens
GB9924060D0 (en) * 1999-10-11 1999-12-15 Chiron Spa VIP54 protein
EP2975127A1 (en) 1999-10-29 2016-01-20 GlaxoSmithKline Biologicals SA Neisserial antigenic peptides
EP2275129A3 (en) 2000-01-17 2013-11-06 Novartis Vaccines and Diagnostics S.r.l. Outer membrane vesicle (OMV) vaccine comprising N. meningitidis serogroup B outer membrane proteins
AU2001266694C1 (en) 2000-06-02 2005-09-01 University Of Connecticut Health Center Complexes of alpha (2) macroglobulin and antigenic molecules for immunotherapy
US20020107368A1 (en) * 2000-12-07 2002-08-08 Jing-Hui Tian Helicobacter proteins, gene sequences and uses thereof
EP2305299B1 (en) 2001-05-31 2017-03-01 GlaxoSmithKline Biologicals SA Chimeric alphavirus replicon particles
GB0115176D0 (en) 2001-06-20 2001-08-15 Chiron Spa Capular polysaccharide solubilisation and combination vaccines
GB0118249D0 (en) 2001-07-26 2001-09-19 Chiron Spa Histidine vaccines
GB0121591D0 (en) 2001-09-06 2001-10-24 Chiron Spa Hybrid and tandem expression of neisserial proteins
JP4384489B2 (en) 2001-08-20 2009-12-16 ユニバーシティー オブ コネティカット ヘルス センター Method for preparing a composition comprising a heat shock protein or α-2-macroglobulin useful for the treatment of cancer and infectious diseases
WO2003070909A2 (en) 2002-02-20 2003-08-28 Chiron Corporation Microparticles with adsorbed polypeptide-containing molecules
EP1547607A4 (en) * 2002-08-02 2008-11-26 Dainippon Sumitomo Pharma Co Bacterial cell wall skeleton component preparation
GB0220194D0 (en) 2002-08-30 2002-10-09 Chiron Spa Improved vesicles
BR0315767A (en) 2002-11-01 2005-09-06 Glaxosmithkline Biolog Sa Immunogenicity composition, method for making a vaccine, kit, vaccine, container with a water repellent inner surface, and method for preserving a composition comprising ipv and a stabilizing agent
PT2279746E (en) 2002-11-15 2013-12-09 Novartis Vaccines & Diagnostic Surface proteins in neisseria meningitidis
GB0227346D0 (en) 2002-11-22 2002-12-31 Chiron Spa 741
WO2004060396A2 (en) 2002-12-27 2004-07-22 Chiron Corporation Immunogenic compositions containing phospholpid
US7893096B2 (en) 2003-03-28 2011-02-22 Novartis Vaccines And Diagnostics, Inc. Use of small molecule compounds for immunopotentiation
GB0308198D0 (en) 2003-04-09 2003-05-14 Chiron Srl ADP-ribosylating bacterial toxin
US7731967B2 (en) 2003-04-30 2010-06-08 Novartis Vaccines And Diagnostics, Inc. Compositions for inducing immune responses
ES2596553T3 (en) 2003-06-02 2017-01-10 Glaxosmithkline Biologicals Sa Immunogenic compositions based on microparticles comprising adsorbed toxoid and an antigen containing a polysaccharide
EP1654283B1 (en) 2003-08-13 2011-07-13 Novartis Vaccines and Diagnostics, Inc. Improved method of purifying tfpi and tfpi analogs
WO2005080414A1 (en) 2004-02-19 2005-09-01 Ramot At Tel-Aviv University Ltd Peptide mimotopes of mycobacterial mannosylated lipoglycans and uses thereof
WO2005102369A1 (en) * 2004-04-22 2005-11-03 Dainippon Sumitomo Pharma Co., Ltd. Pharmaceutical preparation containing bacterial cell wall skeleton component
CA2571421A1 (en) 2004-06-24 2006-01-05 Nicholas Valiante Compounds for immunopotentiation
EP1768662A2 (en) 2004-06-24 2007-04-04 Novartis Vaccines and Diagnostics, Inc. Small molecule immunopotentiators and assays for their detection
DE602005017391D1 (en) 2004-06-24 2009-12-10 Yissum Res Dev Co USE OF PEPTIDE MIMOTOPES OF MANNOSYLATED LIPOGLYCANES FROM MYCOBACTERIA FOR THE TREATMENT OF INFLAMMATION
JP2008508320A (en) 2004-07-29 2008-03-21 カイロン コーポレイション Immunogenic composition against gram positive bacteria such as STREPTOCOCCUSAGALACTIAE
EP1838340B1 (en) * 2004-12-22 2018-04-04 Cleveland Clinic Foundation Flagellin related polypeptides and uses thereof
WO2007047749A1 (en) 2005-10-18 2007-04-26 Novartis Vaccines And Diagnostics Inc. Mucosal and systemic immunizations with alphavirus replicon particles
WO2007081447A2 (en) 2005-11-22 2007-07-19 Novartis Vaccines And Diagnostics, Inc. Norovirus and sapovirus antigens
CA2646539A1 (en) 2006-03-23 2007-09-27 Novartis Ag Imidazoquinoxaline compounds as immunomodulators
KR100846494B1 (en) * 2006-09-26 2008-07-17 삼성전자주식회사 Primer set for amplifying target sequences of Helicobacter pylori method for detecting Helicobacter pylori using the primer set and kit for detecting Helicobacter pylori comprising the primer set
GB0700562D0 (en) 2007-01-11 2007-02-21 Novartis Vaccines & Diagnostic Modified Saccharides
ES2561483T3 (en) 2007-09-12 2016-02-26 Glaxosmithkline Biologicals Sa GAS57 mutant antigens and GAS57 antibodies
KR101773114B1 (en) 2007-12-21 2017-08-30 노파르티스 아게 Mutant forms of streptolysin o
JP5577337B2 (en) 2008-08-01 2014-08-20 クリーブランド バイオラブス, インコーポレイテッド Method for treating reperfusion injury
EP2331127A2 (en) 2008-09-18 2011-06-15 Novartis AG Vaccine adjuvant combinations
US8465751B2 (en) 2009-01-12 2013-06-18 Novartis Ag Cna—B domain antigens in vaccines against gram positive bacteria
AU2010288239B2 (en) 2009-08-27 2014-01-16 Novartis Ag Adjuvant comprising aluminium, oligonucleotide and polycation
MX2012002723A (en) 2009-09-02 2012-04-11 Novartis Ag Immunogenic compositions including tlr activity modulators.
KR20130121699A (en) 2010-05-28 2013-11-06 테트리스 온라인, 인코포레이티드 Interactive hybrid asynchronous computer game infrastructure
ES2458355T3 (en) 2010-09-01 2014-05-05 Novartis Ag Adsorption of immunopotentiators on insoluble metal salts
WO2012082914A1 (en) 2010-12-14 2012-06-21 Novartis Ag Flow cytometry analysis of materials adsorbed to metal salts
AU2012205681B2 (en) 2011-01-10 2016-07-28 Cleveland Biolabs, Inc. Use of toll-like receptor agonist for treating cancer
RU2013144207A (en) 2011-03-02 2015-04-10 Новартис Аг COMBINED VACCINES WITH REDUCED DOSES OF ANTIGEN AND / OR ADJUVANT
WO2013131983A1 (en) 2012-03-07 2013-09-12 Novartis Ag Adjuvanted formulations of streptococcus pneumoniae antigens
DK2822947T3 (en) 2012-03-07 2016-09-19 Glaxosmithkline Biologicals Sa ARGINAL SALTS OF A TLR-7 AGONIST
RU2014140521A (en) 2012-03-08 2016-04-27 Новартис Аг ADJUVANT COMPOSITIONS OF BOOSTER VACCINES
EP2877852B1 (en) * 2012-07-23 2022-05-25 Hermouet, Sylvie A protein microarray for characterizing the specificity of the monoclonal immunoglobulins of mgus or myeloma patients
AU2015296555B2 (en) 2014-07-30 2020-05-21 Genome Protection, Inc. Flagellin compositons and uses
US10183056B2 (en) 2014-10-16 2019-01-22 Cleveland Biolabs, Inc. Methods and compositions for the treatment of radiation-related disorders
SE541618C2 (en) * 2017-02-24 2019-11-12 Biotome Pty Ltd Novel peptides and their use in diagnosis

Family Cites Families (17)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0274482B2 (en) 1986-03-28 2003-03-12 The Board Of Trustees Of The University Of Illinois Isolated dna sequences associated with multidrug resistance in human cells
US5554372A (en) 1986-09-22 1996-09-10 Emory University Methods and vaccines comprising surface-active copolymers
US5459041A (en) * 1988-02-18 1995-10-17 Enteric Research Laboratories, Inc. Campylobacter pylori antigens and uses thereof for detection of Campylobacter pylori infection
US4882271A (en) * 1988-03-10 1989-11-21 Baylor College Of Medicine Process for preparation of high molecular weight cell-associated protein of campylobacter pylori and use for serological detection of campylobacter pylori infection
FR2637612B1 (en) * 1988-10-06 1993-09-10 Pasteur Institut NUCLEOTIDE SEQUENCES ENCODING A PROTEIN WITH UREASIC ACTIVITY
JP3436756B2 (en) 1988-12-19 2003-08-18 アメリカン・サイアナミド・カンパニー Meningococcal class I outer membrane protein vaccine
GB8928625D0 (en) * 1989-12-19 1990-02-21 3I Res Expl Ltd H.pylori dna probes
US5292658A (en) 1989-12-29 1994-03-08 University Of Georgia Research Foundation, Inc. Boyd Graduate Studies Research Center Cloning and expressions of Renilla luciferase
ATE241704T1 (en) 1991-08-27 2003-06-15 Hoffmann La Roche PRIMERS AND BUT FOR DETECTING HEPATITIS C
US5354854A (en) 1991-11-07 1994-10-11 The Curators Of The University Of Missouri Expression system for use in plants to suppress foreign expression and method
US5721349A (en) * 1992-02-26 1998-02-24 Vanderbilt University Vacuolating toxin-deficient H. pylori
IT1262895B (en) 1992-03-02 1996-07-22 Protein extracted from cytotoxic strains of Helicobacter pylori, gene expressing it, use of the protein as a vaccine or for diagnostic purposes.
US5403924A (en) * 1992-10-13 1995-04-04 Vanderbilt University Taga gene and methods for detecting predisposition to peptic ulceration
US5733740A (en) 1992-10-13 1998-03-31 Vanderbilt University Taga gene and methods for detecting predisposition to peptic ulceration and gastric carcinoma
US6019982A (en) * 1994-08-26 2000-02-01 The Administrators Of The Tulane Educational Fund Mutant enterotoxin effective as a non-toxic oral adjuvant
US6902903B1 (en) 1996-12-19 2005-06-07 Chiron Corporation Helicobacter pylori diagnostics
CA2408328C (en) 2000-05-10 2012-04-17 Aventis Pasteur Limited Immunogenic polypeptides encoded by mage minigenes and uses thereof

Also Published As

Publication number Publication date
JP2006055168A (en) 2006-03-02
EP0967279A1 (en) 1999-12-29
DE69333110T2 (en) 2004-05-06
CA2131729A1 (en) 1993-09-16
EP0967279B1 (en) 2008-01-02
JP3368902B2 (en) 2003-01-20
JP2000350591A (en) 2000-12-19
CA2383007A1 (en) 1993-09-16
WO1993018150A1 (en) 1993-09-16
DE69333110D1 (en) 2003-08-28
JP2000333686A (en) 2000-12-05
AU3630093A (en) 1993-10-05
US20040048353A1 (en) 2004-03-11
DE69334197T2 (en) 2008-12-11
US7700755B2 (en) 2010-04-20
US6077706A (en) 2000-06-20
US20050276819A1 (en) 2005-12-15
DE69334197D1 (en) 2008-02-14
JPH07504565A (en) 1995-05-25
JP3408494B2 (en) 2003-05-19

Similar Documents

Publication Publication Date Title
CA2131729C (en) Helicobacter pylori proteins useful for vaccines and diagnostics
EP0643770B1 (en) Helicobacter pylori cytotoxin associated immunodominant antigen useful for vaccines and diagnostics
EP0632727B1 (en) Conjugates formed from heat shock proteins and oligo- or polysaccharides
US7485313B2 (en) Recombinant Chlamydia trachomatis pgp3 protein suitable for enzyme-linked immunoassay, and used of the protein in eliciting and diagnosing an immune response
US6149919A (en) Immunogenic detoxified mutants of cholera toxin and of the toxin LT, their preparation and their use for the preparation of vaccines
CN101684148A (en) Novel surface protein of neisseria meningitidis
WO1995028487A9 (en) Recombinant pgp3, methods of preparation and use in diagnosis and therapy
US5928865A (en) Compositions comprising isolated Helicobacter pylori CagI polynucleotides and method of preparation thereof
US20070243204A1 (en) Helicobacter pylori proteins useful for vaccines and diagnostics
US6130059A (en) Helicobacter pylori proteins useful for vaccines and diagnostics
WO2005014630A2 (en) Streptococcus pneumoniae knockout mutants
WO1993019185A1 (en) Recombinant antigen containing in its sequence a heterologous immunostimulatory domain-use as a vaccine
CA2387188A1 (en) Vip54 protein and related materials

Legal Events

Date Code Title Description
EEER Examination request