US20070148774A1 - Methods for producing members of specific binding pairs - Google Patents
Methods for producing members of specific binding pairs Download PDFInfo
- Publication number
- US20070148774A1 US20070148774A1 US11/555,519 US55551906A US2007148774A1 US 20070148774 A1 US20070148774 A1 US 20070148774A1 US 55551906 A US55551906 A US 55551906A US 2007148774 A1 US2007148774 A1 US 2007148774A1
- Authority
- US
- United States
- Prior art keywords
- phage
- antibody
- binding
- protein
- phagemid
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 238000000034 method Methods 0.000 title claims abstract description 157
- 230000009870 specific binding Effects 0.000 title claims abstract description 34
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 99
- 230000004927 fusion Effects 0.000 claims abstract description 86
- 230000000295 complement effect Effects 0.000 claims abstract description 34
- 230000002068 genetic effect Effects 0.000 claims abstract description 24
- 108090000623 proteins and genes Proteins 0.000 claims description 382
- 230000027455 binding Effects 0.000 claims description 237
- 239000013598 vector Substances 0.000 claims description 129
- 102000004169 proteins and genes Human genes 0.000 claims description 118
- 108020004414 DNA Proteins 0.000 claims description 115
- 239000000427 antigen Substances 0.000 claims description 106
- 108091007433 antigens Proteins 0.000 claims description 106
- 102000036639 antigens Human genes 0.000 claims description 106
- 239000002245 particle Substances 0.000 claims description 73
- 108060003951 Immunoglobulin Proteins 0.000 claims description 47
- 102000018358 immunoglobulin Human genes 0.000 claims description 47
- 150000007523 nucleic acids Chemical class 0.000 claims description 40
- 102000039446 nucleic acids Human genes 0.000 claims description 39
- 108020004707 nucleic acids Proteins 0.000 claims description 39
- 108020001507 fusion proteins Proteins 0.000 claims description 38
- 102000037865 fusion proteins Human genes 0.000 claims description 38
- 239000013612 plasmid Substances 0.000 claims description 36
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 30
- 238000012216 screening Methods 0.000 claims description 24
- 239000002773 nucleotide Substances 0.000 claims description 21
- 125000003729 nucleotide group Chemical group 0.000 claims description 21
- 230000008569 process Effects 0.000 claims description 17
- 241000724791 Filamentous phage Species 0.000 claims description 13
- 239000004365 Protease Substances 0.000 claims description 10
- 230000003612 virological effect Effects 0.000 claims description 10
- 108091005804 Peptidases Proteins 0.000 claims description 8
- 101710125418 Major capsid protein Proteins 0.000 claims description 6
- 101710132601 Capsid protein Proteins 0.000 claims description 2
- 101710094648 Coat protein Proteins 0.000 claims description 2
- 102100021181 Golgi phosphoprotein 3 Human genes 0.000 claims description 2
- 101710141454 Nucleoprotein Proteins 0.000 claims description 2
- 101710083689 Probable capsid protein Proteins 0.000 claims description 2
- 108020005091 Replication Origin Proteins 0.000 claims description 2
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 claims 2
- 102000004196 processed proteins & peptides Human genes 0.000 abstract description 85
- 229920001184 polypeptide Polymers 0.000 abstract description 76
- 230000014509 gene expression Effects 0.000 abstract description 65
- 210000000234 capsid Anatomy 0.000 abstract description 8
- 239000013604 expression vector Substances 0.000 abstract description 6
- 238000007796 conventional method Methods 0.000 abstract description 3
- 210000004027 cell Anatomy 0.000 description 176
- 238000003752 polymerase chain reaction Methods 0.000 description 136
- 229940088598 enzyme Drugs 0.000 description 125
- 239000013615 primer Substances 0.000 description 123
- 239000012634 fragment Substances 0.000 description 113
- 102000004190 Enzymes Human genes 0.000 description 108
- 108090000790 Enzymes Proteins 0.000 description 108
- 235000018102 proteins Nutrition 0.000 description 102
- 238000002965 ELISA Methods 0.000 description 91
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 79
- 239000002953 phosphate buffered saline Substances 0.000 description 79
- 241000282414 Homo sapiens Species 0.000 description 74
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 66
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 66
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 65
- 235000010335 lysozyme Nutrition 0.000 description 64
- 108010014251 Muramidase Proteins 0.000 description 62
- 102000016943 Muramidase Human genes 0.000 description 62
- 108010062010 N-Acetylmuramoyl-L-alanine Amidase Proteins 0.000 description 62
- 229960000274 lysozyme Drugs 0.000 description 62
- 239000004325 lysozyme Substances 0.000 description 62
- 238000010367 cloning Methods 0.000 description 56
- 241000588724 Escherichia coli Species 0.000 description 54
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 52
- 238000003780 insertion Methods 0.000 description 50
- 230000037431 insertion Effects 0.000 description 50
- 239000000203 mixture Substances 0.000 description 49
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 48
- 229940098773 bovine serum albumin Drugs 0.000 description 48
- 241001515965 unidentified phage Species 0.000 description 47
- 108091034117 Oligonucleotide Proteins 0.000 description 44
- 239000006228 supernatant Substances 0.000 description 44
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 44
- 239000000047 product Substances 0.000 description 42
- 238000002360 preparation method Methods 0.000 description 41
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 37
- 241000894006 Bacteria Species 0.000 description 37
- 239000000872 buffer Substances 0.000 description 37
- 230000000694 effects Effects 0.000 description 37
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 36
- 150000001413 amino acids Chemical group 0.000 description 36
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 33
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 33
- HEDRZPFGACZZDS-UHFFFAOYSA-N Chloroform Chemical compound ClC(Cl)Cl HEDRZPFGACZZDS-UHFFFAOYSA-N 0.000 description 32
- 238000010276 construction Methods 0.000 description 32
- 102000005962 receptors Human genes 0.000 description 32
- 108020003175 receptors Proteins 0.000 description 32
- 239000004098 Tetracycline Substances 0.000 description 31
- 238000006243 chemical reaction Methods 0.000 description 31
- 229960002180 tetracycline Drugs 0.000 description 31
- 229930101283 tetracycline Natural products 0.000 description 31
- 235000019364 tetracycline Nutrition 0.000 description 31
- 150000003522 tetracyclines Chemical class 0.000 description 31
- SJHPCNCNNSSLPL-CSKARUKUSA-N (4e)-4-(ethoxymethylidene)-2-phenyl-1,3-oxazol-5-one Chemical compound O1C(=O)C(=C/OCC)\N=C1C1=CC=CC=C1 SJHPCNCNNSSLPL-CSKARUKUSA-N 0.000 description 30
- 235000001014 amino acid Nutrition 0.000 description 30
- 229940024606 amino acid Drugs 0.000 description 30
- 238000013459 approach Methods 0.000 description 29
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 28
- 239000000463 material Substances 0.000 description 28
- 230000035772 mutation Effects 0.000 description 28
- 239000002202 Polyethylene glycol Substances 0.000 description 27
- 229920001223 polyethylene glycol Polymers 0.000 description 27
- 230000001580 bacterial effect Effects 0.000 description 26
- 239000003446 ligand Substances 0.000 description 26
- 239000000523 sample Substances 0.000 description 26
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 25
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 24
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L Magnesium chloride Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 description 24
- 229960000723 ampicillin Drugs 0.000 description 24
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 24
- 230000003321 amplification Effects 0.000 description 24
- 238000003199 nucleic acid amplification method Methods 0.000 description 24
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 23
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 23
- 210000003743 erythrocyte Anatomy 0.000 description 23
- 239000000499 gel Substances 0.000 description 23
- 241000702374 Enterobacteria phage fd Species 0.000 description 22
- 239000011543 agarose gel Substances 0.000 description 22
- 230000029087 digestion Effects 0.000 description 22
- 241000699666 Mus <mouse, genus> Species 0.000 description 21
- ZMANZCXQSJIPKH-UHFFFAOYSA-N Triethylamine Chemical compound CCN(CC)CC ZMANZCXQSJIPKH-UHFFFAOYSA-N 0.000 description 21
- 238000003556 assay Methods 0.000 description 21
- 239000002299 complementary DNA Substances 0.000 description 21
- 230000002950 deficient Effects 0.000 description 21
- 238000002703 mutagenesis Methods 0.000 description 21
- 231100000350 mutagenesis Toxicity 0.000 description 21
- 238000001262 western blot Methods 0.000 description 21
- 238000002955 isolation Methods 0.000 description 20
- 229920002684 Sepharose Polymers 0.000 description 19
- 238000005119 centrifugation Methods 0.000 description 19
- 238000010790 dilution Methods 0.000 description 19
- 239000012895 dilution Substances 0.000 description 19
- 238000011534 incubation Methods 0.000 description 19
- 239000000243 solution Substances 0.000 description 19
- 238000000108 ultra-filtration Methods 0.000 description 19
- 108090000565 Capsid Proteins Proteins 0.000 description 18
- 102100023321 Ceruloplasmin Human genes 0.000 description 18
- UIIMBOGNXHQVGW-UHFFFAOYSA-M Sodium bicarbonate Chemical compound [Na+].OC([O-])=O UIIMBOGNXHQVGW-UHFFFAOYSA-M 0.000 description 18
- 230000012010 growth Effects 0.000 description 18
- 238000000338 in vitro Methods 0.000 description 18
- 239000003471 mutagenic agent Substances 0.000 description 18
- 239000000758 substrate Substances 0.000 description 18
- 241001465754 Metazoa Species 0.000 description 17
- 238000001042 affinity chromatography Methods 0.000 description 17
- 238000004458 analytical method Methods 0.000 description 17
- 238000001514 detection method Methods 0.000 description 17
- 230000006870 function Effects 0.000 description 17
- 239000007160 ty medium Substances 0.000 description 17
- 101100148606 Caenorhabditis elegans pst-1 gene Proteins 0.000 description 16
- 108091026890 Coding region Proteins 0.000 description 16
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 16
- 108091006629 SLC13A2 Proteins 0.000 description 16
- 239000007983 Tris buffer Substances 0.000 description 16
- 238000004091 panning Methods 0.000 description 16
- 108091008146 restriction endonucleases Proteins 0.000 description 16
- 230000000717 retained effect Effects 0.000 description 16
- 108010038512 Platelet-Derived Growth Factor Proteins 0.000 description 15
- 102000010780 Platelet-Derived Growth Factor Human genes 0.000 description 15
- 108010076504 Protein Sorting Signals Proteins 0.000 description 15
- 238000010828 elution Methods 0.000 description 15
- 210000004408 hybridoma Anatomy 0.000 description 15
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 15
- 108010059724 Micrococcal Nuclease Proteins 0.000 description 14
- 230000001965 increasing effect Effects 0.000 description 14
- 102000013415 peroxidase activity proteins Human genes 0.000 description 14
- 108040007629 peroxidase activity proteins Proteins 0.000 description 14
- 239000011780 sodium chloride Substances 0.000 description 14
- 230000009466 transformation Effects 0.000 description 14
- QKCKCXFWENOGER-UHFFFAOYSA-N 2-phenyloxazol-5(4H)-one Chemical compound O1C(=O)CN=C1C1=CC=CC=C1 QKCKCXFWENOGER-UHFFFAOYSA-N 0.000 description 13
- 230000001130 anti-lysozyme effect Effects 0.000 description 13
- 238000002474 experimental method Methods 0.000 description 13
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 13
- 239000011159 matrix material Substances 0.000 description 13
- 239000012528 membrane Substances 0.000 description 13
- 230000010076 replication Effects 0.000 description 13
- QCVGEOXPDFCNHA-UHFFFAOYSA-N 5,5-dimethyl-2,4-dioxo-1,3-oxazolidine-3-carboxamide Chemical compound CC1(C)OC(=O)N(C(N)=O)C1=O QCVGEOXPDFCNHA-UHFFFAOYSA-N 0.000 description 12
- 108010000912 Egg Proteins Proteins 0.000 description 12
- 102000002322 Egg Proteins Human genes 0.000 description 12
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 12
- 108091036060 Linker DNA Proteins 0.000 description 12
- 238000007792 addition Methods 0.000 description 12
- 235000014103 egg white Nutrition 0.000 description 12
- 210000000969 egg white Anatomy 0.000 description 12
- 239000008103 glucose Substances 0.000 description 12
- 229910001629 magnesium chloride Inorganic materials 0.000 description 12
- 238000004519 manufacturing process Methods 0.000 description 12
- 239000008188 pellet Substances 0.000 description 12
- 101150009573 phoA gene Proteins 0.000 description 12
- 238000005406 washing Methods 0.000 description 12
- 241000288147 Meleagris gallopavo Species 0.000 description 11
- 230000003197 catalytic effect Effects 0.000 description 11
- 239000012228 culture supernatant Substances 0.000 description 11
- 238000001556 precipitation Methods 0.000 description 11
- 238000000746 purification Methods 0.000 description 11
- 108700005091 Immunoglobulin Genes Proteins 0.000 description 10
- 102100036011 T-cell surface glycoprotein CD4 Human genes 0.000 description 10
- 241000700605 Viruses Species 0.000 description 10
- 238000002835 absorbance Methods 0.000 description 10
- 239000012141 concentrate Substances 0.000 description 10
- 230000001351 cycling effect Effects 0.000 description 10
- 238000012217 deletion Methods 0.000 description 10
- 230000037430 deletion Effects 0.000 description 10
- 210000004379 membrane Anatomy 0.000 description 10
- 239000012188 paraffin wax Substances 0.000 description 10
- 238000002823 phage display Methods 0.000 description 10
- 239000000843 powder Substances 0.000 description 10
- 230000002829 reductive effect Effects 0.000 description 10
- 241001244729 Apalis Species 0.000 description 9
- 102000053602 DNA Human genes 0.000 description 9
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 9
- 229920001213 Polysorbate 20 Polymers 0.000 description 9
- 238000003314 affinity selection Methods 0.000 description 9
- 229930027917 kanamycin Natural products 0.000 description 9
- 229960000318 kanamycin Drugs 0.000 description 9
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 9
- 229930182823 kanamycin A Natural products 0.000 description 9
- 238000007747 plating Methods 0.000 description 9
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 9
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 9
- 239000011541 reaction mixture Substances 0.000 description 9
- 229910000030 sodium bicarbonate Inorganic materials 0.000 description 9
- 239000000725 suspension Substances 0.000 description 9
- 238000012546 transfer Methods 0.000 description 9
- 210000002845 virion Anatomy 0.000 description 9
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 8
- 101100136076 Aspergillus oryzae (strain ATCC 42149 / RIB 40) pel1 gene Proteins 0.000 description 8
- 108020004705 Codon Proteins 0.000 description 8
- 239000004471 Glycine Substances 0.000 description 8
- 241000283973 Oryctolagus cuniculus Species 0.000 description 8
- 241001494479 Pecora Species 0.000 description 8
- 206010042566 Superinfection Diseases 0.000 description 8
- 239000011230 binding agent Substances 0.000 description 8
- 239000011248 coating agent Substances 0.000 description 8
- 238000000576 coating method Methods 0.000 description 8
- 230000009977 dual effect Effects 0.000 description 8
- PROQIPRRNZUXQM-ZXXIGWHRSA-N estriol Chemical compound OC1=CC=C2[C@H]3CC[C@](C)([C@H]([C@H](O)C4)O)[C@@H]4[C@@H]3CCC2=C1 PROQIPRRNZUXQM-ZXXIGWHRSA-N 0.000 description 8
- 101150040383 pel2 gene Proteins 0.000 description 8
- 101150050446 pelB gene Proteins 0.000 description 8
- 238000012163 sequencing technique Methods 0.000 description 8
- 235000020183 skimmed milk Nutrition 0.000 description 8
- 230000001225 therapeutic effect Effects 0.000 description 8
- 229920001817 Agar Polymers 0.000 description 7
- 241000283707 Capra Species 0.000 description 7
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 7
- 238000012408 PCR amplification Methods 0.000 description 7
- 108010006785 Taq Polymerase Proteins 0.000 description 7
- 239000013504 Triton X-100 Substances 0.000 description 7
- 229920004890 Triton X-100 Polymers 0.000 description 7
- 238000001261 affinity purification Methods 0.000 description 7
- 239000008272 agar Substances 0.000 description 7
- 230000008901 benefit Effects 0.000 description 7
- 230000003115 biocidal effect Effects 0.000 description 7
- 239000003153 chemical reaction reagent Substances 0.000 description 7
- 238000003776 cleavage reaction Methods 0.000 description 7
- 238000013461 design Methods 0.000 description 7
- 239000000539 dimer Substances 0.000 description 7
- 238000001962 electrophoresis Methods 0.000 description 7
- 108010021083 hen egg lysozyme Proteins 0.000 description 7
- 230000001900 immune effect Effects 0.000 description 7
- 238000001114 immunoprecipitation Methods 0.000 description 7
- 210000001322 periplasm Anatomy 0.000 description 7
- 230000007017 scission Effects 0.000 description 7
- 235000017557 sodium bicarbonate Nutrition 0.000 description 7
- 102100039602 ARF GTPase-activating protein GIT2 Human genes 0.000 description 6
- 108010081589 Becaplermin Proteins 0.000 description 6
- 239000003155 DNA primer Substances 0.000 description 6
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 6
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 6
- 241000699670 Mus sp. Species 0.000 description 6
- 102000035195 Peptidases Human genes 0.000 description 6
- 108010029485 Protein Isoforms Proteins 0.000 description 6
- 102000001708 Protein Isoforms Human genes 0.000 description 6
- 101100084022 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) lapA gene Proteins 0.000 description 6
- 108091006231 SLC7A2 Proteins 0.000 description 6
- 108020005038 Terminator Codon Proteins 0.000 description 6
- 239000002253 acid Substances 0.000 description 6
- 239000011324 bead Substances 0.000 description 6
- 239000007795 chemical reaction product Substances 0.000 description 6
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 6
- 235000013601 eggs Nutrition 0.000 description 6
- 239000000284 extract Substances 0.000 description 6
- 238000002649 immunization Methods 0.000 description 6
- 238000001727 in vivo Methods 0.000 description 6
- 230000006698 induction Effects 0.000 description 6
- PHTQWCKDNZKARW-UHFFFAOYSA-N isoamylol Chemical compound CC(C)CCO PHTQWCKDNZKARW-UHFFFAOYSA-N 0.000 description 6
- 239000002609 medium Substances 0.000 description 6
- 210000005105 peripheral blood lymphocyte Anatomy 0.000 description 6
- 230000002441 reversible effect Effects 0.000 description 6
- 230000028327 secretion Effects 0.000 description 6
- 210000000952 spleen Anatomy 0.000 description 6
- NKDFYOWSKOHCCO-YPVLXUMRSA-N 20-hydroxyecdysone Chemical compound C1[C@@H](O)[C@@H](O)C[C@]2(C)[C@@H](CC[C@@]3([C@@H]([C@@](C)(O)[C@H](O)CCC(C)(O)C)CC[C@]33O)C)C3=CC(=O)[C@@H]21 NKDFYOWSKOHCCO-YPVLXUMRSA-N 0.000 description 5
- 239000004475 Arginine Substances 0.000 description 5
- 102100027544 Blood group Rh(D) polypeptide Human genes 0.000 description 5
- 102000000844 Cell Surface Receptors Human genes 0.000 description 5
- 108010001857 Cell Surface Receptors Proteins 0.000 description 5
- 101000580024 Homo sapiens Blood group Rh(D) polypeptide Proteins 0.000 description 5
- 241000725303 Human immunodeficiency virus Species 0.000 description 5
- MHAJPDPJQMAIIY-UHFFFAOYSA-N Hydrogen peroxide Chemical compound OO MHAJPDPJQMAIIY-UHFFFAOYSA-N 0.000 description 5
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 5
- 108060001084 Luciferase Proteins 0.000 description 5
- 101710163270 Nuclease Proteins 0.000 description 5
- 229910019142 PO4 Inorganic materials 0.000 description 5
- 102000004160 Phosphoric Monoester Hydrolases Human genes 0.000 description 5
- 108090000608 Phosphoric Monoester Hydrolases Proteins 0.000 description 5
- 102000005924 Triose-Phosphate Isomerase Human genes 0.000 description 5
- 108700015934 Triose-phosphate isomerases Proteins 0.000 description 5
- 235000004279 alanine Nutrition 0.000 description 5
- 230000000692 anti-sense effect Effects 0.000 description 5
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 5
- 238000007845 assembly PCR Methods 0.000 description 5
- 210000003719 b-lymphocyte Anatomy 0.000 description 5
- 230000008827 biological function Effects 0.000 description 5
- 210000004369 blood Anatomy 0.000 description 5
- 239000008280 blood Substances 0.000 description 5
- 244000309466 calf Species 0.000 description 5
- 238000005520 cutting process Methods 0.000 description 5
- 230000007547 defect Effects 0.000 description 5
- 229940072221 immunoglobulins Drugs 0.000 description 5
- 208000015181 infectious disease Diseases 0.000 description 5
- 230000002458 infectious effect Effects 0.000 description 5
- 238000002844 melting Methods 0.000 description 5
- 230000008018 melting Effects 0.000 description 5
- 230000004048 modification Effects 0.000 description 5
- 238000012986 modification Methods 0.000 description 5
- 230000009871 nonspecific binding Effects 0.000 description 5
- 239000010452 phosphate Substances 0.000 description 5
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 5
- 239000002244 precipitate Substances 0.000 description 5
- 108020001580 protein domains Proteins 0.000 description 5
- 230000012743 protein tagging Effects 0.000 description 5
- 230000009467 reduction Effects 0.000 description 5
- 230000004044 response Effects 0.000 description 5
- 230000003248 secreting effect Effects 0.000 description 5
- 210000002966 serum Anatomy 0.000 description 5
- 238000012360 testing method Methods 0.000 description 5
- 230000002463 transducing effect Effects 0.000 description 5
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 4
- PROQIPRRNZUXQM-UHFFFAOYSA-N (16alpha,17betaOH)-Estra-1,3,5(10)-triene-3,16,17-triol Natural products OC1=CC=C2C3CCC(C)(C(C(O)C4)O)C4C3CCC2=C1 PROQIPRRNZUXQM-UHFFFAOYSA-N 0.000 description 4
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 4
- 102000012410 DNA Ligases Human genes 0.000 description 4
- 108010061982 DNA Ligases Proteins 0.000 description 4
- 108010010803 Gelatin Proteins 0.000 description 4
- 239000000020 Nitrocellulose Substances 0.000 description 4
- 108020004511 Recombinant DNA Proteins 0.000 description 4
- 241000283984 Rodentia Species 0.000 description 4
- 108020004682 Single-Stranded DNA Proteins 0.000 description 4
- 150000007513 acids Chemical class 0.000 description 4
- 210000000628 antibody-producing cell Anatomy 0.000 description 4
- 229940009098 aspartate Drugs 0.000 description 4
- 239000012148 binding buffer Substances 0.000 description 4
- 230000015572 biosynthetic process Effects 0.000 description 4
- 238000010804 cDNA synthesis Methods 0.000 description 4
- AIYUHDOJVYHVIT-UHFFFAOYSA-M caesium chloride Chemical compound [Cl-].[Cs+] AIYUHDOJVYHVIT-UHFFFAOYSA-M 0.000 description 4
- 230000015556 catabolic process Effects 0.000 description 4
- 230000008859 change Effects 0.000 description 4
- 239000003795 chemical substances by application Substances 0.000 description 4
- 230000009089 cytolysis Effects 0.000 description 4
- VHJLVAABSRFDPM-QWWZWVQMSA-N dithiothreitol Chemical compound SC[C@@H](O)[C@H](O)CS VHJLVAABSRFDPM-QWWZWVQMSA-N 0.000 description 4
- 229960003692 gamma aminobutyric acid Drugs 0.000 description 4
- 239000008273 gelatin Substances 0.000 description 4
- 229920000159 gelatin Polymers 0.000 description 4
- 235000019322 gelatine Nutrition 0.000 description 4
- 235000011852 gelatine desserts Nutrition 0.000 description 4
- 238000010438 heat treatment Methods 0.000 description 4
- 230000028993 immune response Effects 0.000 description 4
- 230000002163 immunogen Effects 0.000 description 4
- 230000002779 inactivation Effects 0.000 description 4
- 230000003993 interaction Effects 0.000 description 4
- 210000004698 lymphocyte Anatomy 0.000 description 4
- 239000012139 lysis buffer Substances 0.000 description 4
- 210000004962 mammalian cell Anatomy 0.000 description 4
- 239000003550 marker Substances 0.000 description 4
- 235000013336 milk Nutrition 0.000 description 4
- 239000008267 milk Substances 0.000 description 4
- 210000004080 milk Anatomy 0.000 description 4
- 238000002156 mixing Methods 0.000 description 4
- 229920001220 nitrocellulos Polymers 0.000 description 4
- 229920002401 polyacrylamide Polymers 0.000 description 4
- 235000019419 proteases Nutrition 0.000 description 4
- 238000010188 recombinant method Methods 0.000 description 4
- 238000011160 research Methods 0.000 description 4
- 238000005070 sampling Methods 0.000 description 4
- 238000010561 standard procedure Methods 0.000 description 4
- 239000000126 substance Substances 0.000 description 4
- 238000004448 titration Methods 0.000 description 4
- 231100000331 toxic Toxicity 0.000 description 4
- 230000002588 toxic effect Effects 0.000 description 4
- 230000014616 translation Effects 0.000 description 4
- SNBCLPGEMZEWLU-QXFUBDJGSA-N 2-chloro-n-[[(2r,3s,5r)-3-hydroxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methyl]acetamide Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CNC(=O)CCl)[C@@H](O)C1 SNBCLPGEMZEWLU-QXFUBDJGSA-N 0.000 description 3
- XZKIHKMTEMTJQX-UHFFFAOYSA-N 4-Nitrophenyl Phosphate Chemical compound OP(O)(=O)OC1=CC=C([N+]([O-])=O)C=C1 XZKIHKMTEMTJQX-UHFFFAOYSA-N 0.000 description 3
- 108010039627 Aprotinin Proteins 0.000 description 3
- 101710192393 Attachment protein G3P Proteins 0.000 description 3
- 108700023313 Bacteriophage Receptors Proteins 0.000 description 3
- 101100275473 Caenorhabditis elegans ctc-3 gene Proteins 0.000 description 3
- 101710169873 Capsid protein G8P Proteins 0.000 description 3
- 230000004543 DNA replication Effects 0.000 description 3
- 238000012286 ELISA Assay Methods 0.000 description 3
- 241001288713 Escherichia coli MC1061 Species 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 241000282412 Homo Species 0.000 description 3
- 101001018100 Homo sapiens Lysozyme C Proteins 0.000 description 3
- 101000610551 Homo sapiens Prominin-1 Proteins 0.000 description 3
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 3
- 102100024319 Intestinal-type alkaline phosphatase Human genes 0.000 description 3
- 101710184243 Intestinal-type alkaline phosphatase Proteins 0.000 description 3
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 3
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 3
- 239000005089 Luciferase Substances 0.000 description 3
- 101710156564 Major tail protein Gp23 Proteins 0.000 description 3
- 241001529936 Murinae Species 0.000 description 3
- 101710135898 Myc proto-oncogene protein Proteins 0.000 description 3
- 102100038895 Myc proto-oncogene protein Human genes 0.000 description 3
- 239000005662 Paraffin oil Substances 0.000 description 3
- YNPNZTXNASCQKK-UHFFFAOYSA-N Phenanthrene Natural products C1=CC=C2C3=CC=CC=C3C=CC2=C1 YNPNZTXNASCQKK-UHFFFAOYSA-N 0.000 description 3
- 102100040120 Prominin-1 Human genes 0.000 description 3
- 101000717877 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) 40S ribosomal protein S11-A Proteins 0.000 description 3
- 101000717881 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) 40S ribosomal protein S11-B Proteins 0.000 description 3
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 3
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 3
- 101800002899 Soluble alkaline phosphatase Proteins 0.000 description 3
- 101710150448 Transcriptional regulator Myc Proteins 0.000 description 3
- DGEZNRSVGBDHLK-UHFFFAOYSA-N [1,10]phenanthroline Chemical compound C1=CN=C2C3=NC=CC=C3C=CC2=C1 DGEZNRSVGBDHLK-UHFFFAOYSA-N 0.000 description 3
- 125000003295 alanine group Chemical group N[C@@H](C)C(=O)* 0.000 description 3
- 230000004075 alteration Effects 0.000 description 3
- 238000000137 annealing Methods 0.000 description 3
- 230000003302 anti-idiotype Effects 0.000 description 3
- OHDRQQURAXLVGJ-HLVWOLMTSA-N azane;(2e)-3-ethyl-2-[(e)-(3-ethyl-6-sulfo-1,3-benzothiazol-2-ylidene)hydrazinylidene]-1,3-benzothiazole-6-sulfonic acid Chemical compound [NH4+].[NH4+].S/1C2=CC(S([O-])(=O)=O)=CC=C2N(CC)C\1=N/N=C1/SC2=CC(S([O-])(=O)=O)=CC=C2N1CC OHDRQQURAXLVGJ-HLVWOLMTSA-N 0.000 description 3
- 108010058966 bacteriophage T7 induced DNA polymerase Proteins 0.000 description 3
- 238000009835 boiling Methods 0.000 description 3
- 210000004899 c-terminal region Anatomy 0.000 description 3
- 230000030833 cell death Effects 0.000 description 3
- 239000007979 citrate buffer Substances 0.000 description 3
- 230000002860 competitive effect Effects 0.000 description 3
- 238000011109 contamination Methods 0.000 description 3
- 239000013256 coordination polymer Substances 0.000 description 3
- 238000006731 degradation reaction Methods 0.000 description 3
- 238000004925 denaturation Methods 0.000 description 3
- 230000036425 denaturation Effects 0.000 description 3
- 201000010099 disease Diseases 0.000 description 3
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 3
- 238000006073 displacement reaction Methods 0.000 description 3
- 238000010494 dissociation reaction Methods 0.000 description 3
- 230000005593 dissociations Effects 0.000 description 3
- -1 e.g. Proteins 0.000 description 3
- 230000036541 health Effects 0.000 description 3
- 238000009396 hybridization Methods 0.000 description 3
- 230000003053 immunization Effects 0.000 description 3
- 230000001524 infective effect Effects 0.000 description 3
- 239000003112 inhibitor Substances 0.000 description 3
- 230000014759 maintenance of location Effects 0.000 description 3
- 229940126619 mouse monoclonal antibody Drugs 0.000 description 3
- 101150029530 mutT1 gene Proteins 0.000 description 3
- 229920000136 polysorbate Polymers 0.000 description 3
- 238000010791 quenching Methods 0.000 description 3
- 108010043277 recombinant soluble CD4 Proteins 0.000 description 3
- 230000035945 sensitivity Effects 0.000 description 3
- 238000000926 separation method Methods 0.000 description 3
- 238000002741 site-directed mutagenesis Methods 0.000 description 3
- 239000007787 solid Substances 0.000 description 3
- 238000009987 spinning Methods 0.000 description 3
- 210000004989 spleen cell Anatomy 0.000 description 3
- 238000003786 synthesis reaction Methods 0.000 description 3
- 210000001519 tissue Anatomy 0.000 description 3
- 238000013518 transcription Methods 0.000 description 3
- 230000035897 transcription Effects 0.000 description 3
- 238000001890 transfection Methods 0.000 description 3
- 238000013519 translation Methods 0.000 description 3
- PIEPQKCYPFFYMG-UHFFFAOYSA-N tris acetate Chemical compound CC(O)=O.OCC(N)(CO)CO PIEPQKCYPFFYMG-UHFFFAOYSA-N 0.000 description 3
- QBHBHOSRLDPIHG-UHFFFAOYSA-N (4-hydroxy-3-nitrophenyl)acetic acid Chemical compound OC(=O)CC1=CC=C(O)C([N+]([O-])=O)=C1 QBHBHOSRLDPIHG-UHFFFAOYSA-N 0.000 description 2
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical compound COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 description 2
- QMVDSTMRMBTHIF-UHFFFAOYSA-N 4-methylidene-2-phenyl-1,3-oxazol-5-one Chemical compound O1C(=O)C(=C)N=C1C1=CC=CC=C1 QMVDSTMRMBTHIF-UHFFFAOYSA-N 0.000 description 2
- 229920000936 Agarose Polymers 0.000 description 2
- 244000153158 Ammi visnaga Species 0.000 description 2
- 235000010585 Ammi visnaga Nutrition 0.000 description 2
- DJHGAFSJWGLOIV-UHFFFAOYSA-K Arsenate3- Chemical compound [O-][As]([O-])([O-])=O DJHGAFSJWGLOIV-UHFFFAOYSA-K 0.000 description 2
- 241000713838 Avian myeloblastosis virus Species 0.000 description 2
- 241000212384 Bifora Species 0.000 description 2
- 101800001415 Bri23 peptide Proteins 0.000 description 2
- 101800000655 C-terminal peptide Proteins 0.000 description 2
- 102400000107 C-terminal peptide Human genes 0.000 description 2
- 101100451301 Caenorhabditis elegans mls-2 gene Proteins 0.000 description 2
- 102000014914 Carrier Proteins Human genes 0.000 description 2
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 2
- 208000003322 Coinfection Diseases 0.000 description 2
- 238000001712 DNA sequencing Methods 0.000 description 2
- 102100024360 Dual oxidase maturation factor 1 Human genes 0.000 description 2
- 241001524679 Escherichia virus M13 Species 0.000 description 2
- 101710179596 Gene 3 protein Proteins 0.000 description 2
- 101100297421 Homarus americanus phc-2 gene Proteins 0.000 description 2
- 101100005713 Homo sapiens CD4 gene Proteins 0.000 description 2
- 101001052938 Homo sapiens Dual oxidase maturation factor 1 Proteins 0.000 description 2
- 102000002265 Human Growth Hormone Human genes 0.000 description 2
- 108010000521 Human Growth Hormone Proteins 0.000 description 2
- 239000000854 Human Growth Hormone Substances 0.000 description 2
- 102100034343 Integrase Human genes 0.000 description 2
- 235000019687 Lamb Nutrition 0.000 description 2
- 102000003960 Ligases Human genes 0.000 description 2
- 108090000364 Ligases Proteins 0.000 description 2
- 206010028980 Neoplasm Diseases 0.000 description 2
- 108091008606 PDGF receptors Proteins 0.000 description 2
- 108090000526 Papain Proteins 0.000 description 2
- 102000011653 Platelet-Derived Growth Factor Receptors Human genes 0.000 description 2
- 108010092799 RNA-directed DNA polymerase Proteins 0.000 description 2
- 102100037968 Ribonuclease inhibitor Human genes 0.000 description 2
- 108010083644 Ribonucleases Proteins 0.000 description 2
- 102000006382 Ribonucleases Human genes 0.000 description 2
- 101000865057 Thermococcus litoralis DNA polymerase Proteins 0.000 description 2
- 108010034949 Thyroglobulin Proteins 0.000 description 2
- 102000009843 Thyroglobulin Human genes 0.000 description 2
- 101150117115 V gene Proteins 0.000 description 2
- 230000001594 aberrant effect Effects 0.000 description 2
- 230000009824 affinity maturation Effects 0.000 description 2
- 238000000246 agarose gel electrophoresis Methods 0.000 description 2
- 230000004520 agglutination Effects 0.000 description 2
- 125000000637 arginyl group Chemical group N[C@@H](CCCNC(N)=N)C(=O)* 0.000 description 2
- 229940000489 arsenate Drugs 0.000 description 2
- 238000002820 assay format Methods 0.000 description 2
- 108091008324 binding proteins Proteins 0.000 description 2
- 230000004071 biological effect Effects 0.000 description 2
- 229960002685 biotin Drugs 0.000 description 2
- 235000020958 biotin Nutrition 0.000 description 2
- 239000011616 biotin Substances 0.000 description 2
- 210000000170 cell membrane Anatomy 0.000 description 2
- 230000001413 cellular effect Effects 0.000 description 2
- 238000004587 chromatography analysis Methods 0.000 description 2
- 239000003593 chromogenic compound Substances 0.000 description 2
- 230000004186 co-expression Effects 0.000 description 2
- 230000009260 cross reactivity Effects 0.000 description 2
- 210000000172 cytosol Anatomy 0.000 description 2
- SUYVUBYJARFZHO-RRKCRQDMSA-N dATP Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@H]1C[C@H](O)[C@@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)O1 SUYVUBYJARFZHO-RRKCRQDMSA-N 0.000 description 2
- HAAZLUGHYHWQIW-KVQBGUIXSA-N dGTP Chemical compound C1=NC=2C(=O)NC(N)=NC=2N1[C@H]1C[C@H](O)[C@@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)O1 HAAZLUGHYHWQIW-KVQBGUIXSA-N 0.000 description 2
- NHVNXKFIZYSCEB-XLPZGREQSA-N dTTP Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)[C@@H](O)C1 NHVNXKFIZYSCEB-XLPZGREQSA-N 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- 239000003599 detergent Substances 0.000 description 2
- 239000003814 drug Substances 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- DEFVIWRASFVYLL-UHFFFAOYSA-N ethylene glycol bis(2-aminoethyl)tetraacetic acid Chemical compound OC(=O)CN(CC(O)=O)CCOCCOCCN(CC(O)=O)CC(O)=O DEFVIWRASFVYLL-UHFFFAOYSA-N 0.000 description 2
- 230000005284 excitation Effects 0.000 description 2
- 238000007429 general method Methods 0.000 description 2
- 230000009395 genetic defect Effects 0.000 description 2
- 210000004602 germ cell Anatomy 0.000 description 2
- 239000011521 glass Substances 0.000 description 2
- 102000006602 glyceraldehyde-3-phosphate dehydrogenase Human genes 0.000 description 2
- 108020004445 glyceraldehyde-3-phosphate dehydrogenase Proteins 0.000 description 2
- 210000000987 immune system Anatomy 0.000 description 2
- 108010023260 immunoglobulin Fv Proteins 0.000 description 2
- 229910052816 inorganic phosphate Inorganic materials 0.000 description 2
- 238000002372 labelling Methods 0.000 description 2
- 231100000518 lethal Toxicity 0.000 description 2
- 230000001665 lethal effect Effects 0.000 description 2
- 238000011068 loading method Methods 0.000 description 2
- 238000005259 measurement Methods 0.000 description 2
- MYWUZJCMWCOHBA-VIFPVBQESA-N methamphetamine Chemical compound CN[C@@H](C)CC1=CC=CC=C1 MYWUZJCMWCOHBA-VIFPVBQESA-N 0.000 description 2
- 239000000178 monomer Substances 0.000 description 2
- 210000004897 n-terminal region Anatomy 0.000 description 2
- 239000013642 negative control Substances 0.000 description 2
- 230000003472 neutralizing effect Effects 0.000 description 2
- 230000003287 optical effect Effects 0.000 description 2
- 210000000056 organ Anatomy 0.000 description 2
- 238000004806 packaging method and process Methods 0.000 description 2
- 229940055729 papain Drugs 0.000 description 2
- 235000019834 papain Nutrition 0.000 description 2
- 238000002264 polyacrylamide gel electrophoresis Methods 0.000 description 2
- 238000012545 processing Methods 0.000 description 2
- 230000035755 proliferation Effects 0.000 description 2
- 230000006337 proteolytic cleavage Effects 0.000 description 2
- 238000002708 random mutagenesis Methods 0.000 description 2
- 230000008707 rearrangement Effects 0.000 description 2
- 230000006798 recombination Effects 0.000 description 2
- 238000005215 recombination Methods 0.000 description 2
- 238000011084 recovery Methods 0.000 description 2
- 239000012465 retentate Substances 0.000 description 2
- 238000010839 reverse transcription Methods 0.000 description 2
- 239000003161 ribonuclease inhibitor Substances 0.000 description 2
- 239000012146 running buffer Substances 0.000 description 2
- 238000013207 serial dilution Methods 0.000 description 2
- 238000002791 soaking Methods 0.000 description 2
- 239000001509 sodium citrate Substances 0.000 description 2
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 2
- 238000001179 sorption measurement Methods 0.000 description 2
- ATHGHQPFGPMSJY-UHFFFAOYSA-N spermidine Chemical compound NCCCCNCCCN ATHGHQPFGPMSJY-UHFFFAOYSA-N 0.000 description 2
- 239000003270 steroid hormone Substances 0.000 description 2
- 238000006467 substitution reaction Methods 0.000 description 2
- 101150061166 tetR gene Proteins 0.000 description 2
- 229960002175 thyroglobulin Drugs 0.000 description 2
- 238000000844 transformation Methods 0.000 description 2
- 230000001131 transforming effect Effects 0.000 description 2
- 230000007704 transition Effects 0.000 description 2
- 239000013638 trimer Substances 0.000 description 2
- 238000011144 upstream manufacturing Methods 0.000 description 2
- 230000035899 viability Effects 0.000 description 2
- 238000010626 work up procedure Methods 0.000 description 2
- GGKNTGJPGZQNID-UHFFFAOYSA-N (1-$l^{1}-oxidanyl-2,2,6,6-tetramethylpiperidin-4-yl)-trimethylazanium Chemical compound CC1(C)CC([N+](C)(C)C)CC(C)(C)N1[O] GGKNTGJPGZQNID-UHFFFAOYSA-N 0.000 description 1
- KPWFDZXSCIFGNO-UHFFFAOYSA-N (4-hydroxy-3-iodo-5-nitrophenyl)acetic acid Chemical compound OC(=O)CC1=CC(I)=C(O)C([N+]([O-])=O)=C1 KPWFDZXSCIFGNO-UHFFFAOYSA-N 0.000 description 1
- HDMYKJVSQIHZLM-UHFFFAOYSA-N 1-[3,5-di(pyren-1-yl)phenyl]pyrene Chemical compound C1=CC(C=2C=C(C=C(C=2)C=2C3=CC=C4C=CC=C5C=CC(C3=C54)=CC=2)C=2C3=CC=C4C=CC=C5C=CC(C3=C54)=CC=2)=C2C=CC3=CC=CC4=CC=C1C2=C43 HDMYKJVSQIHZLM-UHFFFAOYSA-N 0.000 description 1
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 1
- VLEIUWBSEKKKFX-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;2-[2-[bis(carboxymethyl)amino]ethyl-(carboxymethyl)amino]acetic acid Chemical compound OCC(N)(CO)CO.OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O VLEIUWBSEKKKFX-UHFFFAOYSA-N 0.000 description 1
- HSTOKWSFWGCZMH-UHFFFAOYSA-N 3,3'-diaminobenzidine Chemical compound C1=C(N)C(N)=CC=C1C1=CC=C(N)C(N)=C1 HSTOKWSFWGCZMH-UHFFFAOYSA-N 0.000 description 1
- PCDWFBFHIIKIPM-UHFFFAOYSA-N 3-ethyl-2h-1,3-benzothiazole-2-sulfonic acid Chemical compound C1=CC=C2N(CC)C(S(O)(=O)=O)SC2=C1 PCDWFBFHIIKIPM-UHFFFAOYSA-N 0.000 description 1
- KJDSORYAHBAGPP-UHFFFAOYSA-N 4-(3,4-diaminophenyl)benzene-1,2-diamine;hydron;tetrachloride Chemical compound Cl.Cl.Cl.Cl.C1=C(N)C(N)=CC=C1C1=CC=C(N)C(N)=C1 KJDSORYAHBAGPP-UHFFFAOYSA-N 0.000 description 1
- CNNSWSHYGANWBM-UHFFFAOYSA-N 6-chloro-2,3-dimethylquinoxaline Chemical compound C1=C(Cl)C=C2N=C(C)C(C)=NC2=C1 CNNSWSHYGANWBM-UHFFFAOYSA-N 0.000 description 1
- 208000030507 AIDS Diseases 0.000 description 1
- 102100039601 ARF GTPase-activating protein GIT1 Human genes 0.000 description 1
- 101710194905 ARF GTPase-activating protein GIT1 Proteins 0.000 description 1
- 102000009027 Albumins Human genes 0.000 description 1
- 108010088751 Albumins Proteins 0.000 description 1
- USFZMSVCRYTOJT-UHFFFAOYSA-N Ammonium acetate Chemical compound N.CC(O)=O USFZMSVCRYTOJT-UHFFFAOYSA-N 0.000 description 1
- 239000005695 Ammonium acetate Substances 0.000 description 1
- 241000370685 Arge Species 0.000 description 1
- 101100290837 Bacillus subtilis (strain 168) metAA gene Proteins 0.000 description 1
- 208000035143 Bacterial infection Diseases 0.000 description 1
- 101150116295 CAT2 gene Proteins 0.000 description 1
- 108010041397 CD4 Antigens Proteins 0.000 description 1
- PCDQPRRSZKQHHS-XVFCMESISA-N CTP Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)O1 PCDQPRRSZKQHHS-XVFCMESISA-N 0.000 description 1
- 101100326920 Caenorhabditis elegans ctl-1 gene Proteins 0.000 description 1
- 101100189378 Caenorhabditis elegans pat-3 gene Proteins 0.000 description 1
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 1
- 102000016289 Cell Adhesion Molecules Human genes 0.000 description 1
- 108010067225 Cell Adhesion Molecules Proteins 0.000 description 1
- CXRFDZFCGOPDTD-UHFFFAOYSA-M Cetrimide Chemical compound [Br-].CCCCCCCCCCCCCC[N+](C)(C)C CXRFDZFCGOPDTD-UHFFFAOYSA-M 0.000 description 1
- 108010038061 Chymotrypsinogen Proteins 0.000 description 1
- 241001429175 Colitis phage Species 0.000 description 1
- 241000557626 Corvus corax Species 0.000 description 1
- 108010052832 Cytochromes Proteins 0.000 description 1
- 102000018832 Cytochromes Human genes 0.000 description 1
- 125000000824 D-ribofuranosyl group Chemical group [H]OC([H])([H])[C@@]1([H])OC([H])(*)[C@]([H])(O[H])[C@]1([H])O[H] 0.000 description 1
- 108010017826 DNA Polymerase I Proteins 0.000 description 1
- 102000004594 DNA Polymerase I Human genes 0.000 description 1
- 238000007399 DNA isolation Methods 0.000 description 1
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 1
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 1
- 101710088194 Dehydrogenase Proteins 0.000 description 1
- 241000283074 Equus asinus Species 0.000 description 1
- 241000701959 Escherichia virus Lambda Species 0.000 description 1
- 108010014173 Factor X Proteins 0.000 description 1
- 108010008177 Fd immunoglobulins Proteins 0.000 description 1
- 229920001917 Ficoll Polymers 0.000 description 1
- 101710177291 Gag polyprotein Proteins 0.000 description 1
- 241001669573 Galeorhinus galeus Species 0.000 description 1
- 241000287828 Gallus gallus Species 0.000 description 1
- 102000018997 Growth Hormone Human genes 0.000 description 1
- 108010051696 Growth Hormone Proteins 0.000 description 1
- 239000007995 HEPES buffer Substances 0.000 description 1
- 102000005548 Hexokinase Human genes 0.000 description 1
- 108700040460 Hexokinases Proteins 0.000 description 1
- 101710081758 High affinity cationic amino acid transporter 1 Proteins 0.000 description 1
- 101000777314 Homo sapiens Choline kinase alpha Proteins 0.000 description 1
- 101000777313 Homo sapiens Choline/ethanolamine kinase Proteins 0.000 description 1
- 101000935587 Homo sapiens Flavin reductase (NADPH) Proteins 0.000 description 1
- 101001138544 Homo sapiens UMP-CMP kinase Proteins 0.000 description 1
- 101001082397 Human adenovirus B serotype 3 Hexon-associated protein Proteins 0.000 description 1
- 206010020751 Hypersensitivity Diseases 0.000 description 1
- 206010062016 Immunosuppression Diseases 0.000 description 1
- 108091029795 Intergenic region Proteins 0.000 description 1
- 125000000570 L-alpha-aspartyl group Chemical group [H]OC(=O)C([H])([H])[C@]([H])(N([H])[H])C(*)=O 0.000 description 1
- 102000043131 MHC class II family Human genes 0.000 description 1
- 108091054438 MHC class II family Proteins 0.000 description 1
- 102000018697 Membrane Proteins Human genes 0.000 description 1
- 108010052285 Membrane Proteins Proteins 0.000 description 1
- 241001538234 Nala Species 0.000 description 1
- 101100126846 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) katG gene Proteins 0.000 description 1
- 108020005187 Oligonucleotide Probes Proteins 0.000 description 1
- 101710116435 Outer membrane protein Proteins 0.000 description 1
- 108010058846 Ovalbumin Proteins 0.000 description 1
- 239000002033 PVDF binder Substances 0.000 description 1
- 102000007079 Peptide Fragments Human genes 0.000 description 1
- 108010033276 Peptide Fragments Proteins 0.000 description 1
- YGYAWVDWMABLBF-UHFFFAOYSA-N Phosgene Chemical compound ClC(Cl)=O YGYAWVDWMABLBF-UHFFFAOYSA-N 0.000 description 1
- 108091000080 Phosphotransferase Proteins 0.000 description 1
- 229920002594 Polyethylene Glycol 8000 Polymers 0.000 description 1
- 108010021757 Polynucleotide 5'-Hydroxyl-Kinase Proteins 0.000 description 1
- 102000008422 Polynucleotide 5'-hydroxyl-kinase Human genes 0.000 description 1
- 239000004743 Polypropylene Substances 0.000 description 1
- 108010001267 Protein Subunits Proteins 0.000 description 1
- 101001120093 Pseudoalteromonas phage PM2 Protein P8 Proteins 0.000 description 1
- LCTONWCANYUPML-UHFFFAOYSA-M Pyruvate Chemical compound CC(=O)C([O-])=O LCTONWCANYUPML-UHFFFAOYSA-M 0.000 description 1
- 101710141795 Ribonuclease inhibitor Proteins 0.000 description 1
- 229940122208 Ribonuclease inhibitor Drugs 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- 241000607142 Salmonella Species 0.000 description 1
- 101100421709 Schistosoma mansoni SM21.7 gene Proteins 0.000 description 1
- 108091081021 Sense strand Proteins 0.000 description 1
- 238000012300 Sequence Analysis Methods 0.000 description 1
- 108010071390 Serum Albumin Proteins 0.000 description 1
- 102000007562 Serum Albumin Human genes 0.000 description 1
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 1
- 108091008874 T cell receptors Proteins 0.000 description 1
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 1
- 101710099760 Tetracycline resistance protein Proteins 0.000 description 1
- 241000589500 Thermus aquaticus Species 0.000 description 1
- 108090000190 Thrombin Proteins 0.000 description 1
- 101710120037 Toxin CcdB Proteins 0.000 description 1
- 239000007984 Tris EDTA buffer Substances 0.000 description 1
- 101710162629 Trypsin inhibitor Proteins 0.000 description 1
- 229940122618 Trypsin inhibitor Drugs 0.000 description 1
- 108700005077 Viral Genes Proteins 0.000 description 1
- SXEHKFHPFVVDIR-UHFFFAOYSA-N [4-(4-hydrazinylphenyl)phenyl]hydrazine Chemical compound C1=CC(NN)=CC=C1C1=CC=C(NN)C=C1 SXEHKFHPFVVDIR-UHFFFAOYSA-N 0.000 description 1
- DOEADYYICZVJDD-UHFFFAOYSA-N [4-[(4-aminophenyl)diazenyl]phenyl]arsonic acid Chemical compound C1=CC(N)=CC=C1N=NC1=CC=C([As](O)(O)=O)C=C1 DOEADYYICZVJDD-UHFFFAOYSA-N 0.000 description 1
- QPMSXSBEVQLBIL-CZRHPSIPSA-N ac1mix0p Chemical compound C1=CC=C2N(C[C@H](C)CN(C)C)C3=CC(OC)=CC=C3SC2=C1.O([C@H]1[C@]2(OC)C=CC34C[C@@H]2[C@](C)(O)CCC)C2=C5[C@]41CCN(C)[C@@H]3CC5=CC=C2O QPMSXSBEVQLBIL-CZRHPSIPSA-N 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- 235000019647 acidic taste Nutrition 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 238000007818 agglutination assay Methods 0.000 description 1
- 230000000961 alloantigen Effects 0.000 description 1
- BWZOPYPOZJBVLQ-UHFFFAOYSA-K aluminium glycinate Chemical group O[Al+]O.NCC([O-])=O BWZOPYPOZJBVLQ-UHFFFAOYSA-K 0.000 description 1
- 229940124277 aminobutyric acid Drugs 0.000 description 1
- 229960002684 aminocaproic acid Drugs 0.000 description 1
- 235000019257 ammonium acetate Nutrition 0.000 description 1
- 229940043376 ammonium acetate Drugs 0.000 description 1
- BFNBIHQBYMNNAN-UHFFFAOYSA-N ammonium sulfate Chemical compound N.N.OS(O)(=O)=O BFNBIHQBYMNNAN-UHFFFAOYSA-N 0.000 description 1
- 229910052921 ammonium sulfate Inorganic materials 0.000 description 1
- 239000001166 ammonium sulphate Substances 0.000 description 1
- 235000011130 ammonium sulphate Nutrition 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 230000009830 antibody antigen interaction Effects 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 230000003078 antioxidant effect Effects 0.000 description 1
- 208000022362 bacterial infectious disease Diseases 0.000 description 1
- 229960002319 barbital Drugs 0.000 description 1
- FTOAOBMCPZCFFF-UHFFFAOYSA-N barbitone sodium Natural products CCC1(CC)C(=O)NC(=O)NC1=O FTOAOBMCPZCFFF-UHFFFAOYSA-N 0.000 description 1
- 102000012740 beta Adrenergic Receptors Human genes 0.000 description 1
- 108010079452 beta Adrenergic Receptors Proteins 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- 108010005774 beta-Galactosidase Proteins 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 229960000074 biopharmaceutical Drugs 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- UDSAIICHUKSCKT-UHFFFAOYSA-N bromophenol blue Chemical compound C1=C(Br)C(O)=C(Br)C=C1C1(C=2C=C(Br)C(O)=C(Br)C=2)C2=CC=CC=C2S(=O)(=O)O1 UDSAIICHUKSCKT-UHFFFAOYSA-N 0.000 description 1
- 239000001110 calcium chloride Substances 0.000 description 1
- 229910001628 calcium chloride Inorganic materials 0.000 description 1
- 229940041514 candida albicans extract Drugs 0.000 description 1
- GGNALUCSASGNCK-UHFFFAOYSA-N carbon dioxide;propan-2-ol Chemical compound O=C=O.CC(C)O GGNALUCSASGNCK-UHFFFAOYSA-N 0.000 description 1
- 239000003054 catalyst Substances 0.000 description 1
- 238000006555 catalytic reaction Methods 0.000 description 1
- 230000007910 cell fusion Effects 0.000 description 1
- 108091092328 cellular RNA Proteins 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 1
- YTRQFSDWAXHJCC-UHFFFAOYSA-N chloroform;phenol Chemical compound ClC(Cl)Cl.OC1=CC=CC=C1 YTRQFSDWAXHJCC-UHFFFAOYSA-N 0.000 description 1
- GVPFVAHMJGGAJG-UHFFFAOYSA-L cobalt dichloride Chemical compound [Cl-].[Cl-].[Co+2] GVPFVAHMJGGAJG-UHFFFAOYSA-L 0.000 description 1
- 238000004891 communication Methods 0.000 description 1
- 230000006854 communication Effects 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- ATDGTVJJHBUTRL-UHFFFAOYSA-N cyanogen bromide Chemical compound BrC#N ATDGTVJJHBUTRL-UHFFFAOYSA-N 0.000 description 1
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 1
- 108091092330 cytoplasmic RNA Proteins 0.000 description 1
- 231100000433 cytotoxic Toxicity 0.000 description 1
- 230000001472 cytotoxic effect Effects 0.000 description 1
- SUYVUBYJARFZHO-UHFFFAOYSA-N dATP Natural products C1=NC=2C(N)=NC=NC=2N1C1CC(O)C(COP(O)(=O)OP(O)(=O)OP(O)(O)=O)O1 SUYVUBYJARFZHO-UHFFFAOYSA-N 0.000 description 1
- RGWHQCVHVJXOKC-SHYZEUOFSA-J dCTP(4-) Chemical compound O=C1N=C(N)C=CN1[C@@H]1O[C@H](COP([O-])(=O)OP([O-])(=O)OP([O-])([O-])=O)[C@@H](O)C1 RGWHQCVHVJXOKC-SHYZEUOFSA-J 0.000 description 1
- 239000007857 degradation product Substances 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 238000002405 diagnostic procedure Methods 0.000 description 1
- 238000000502 dialysis Methods 0.000 description 1
- FFYPMLJYZAEMQB-UHFFFAOYSA-N diethyl pyrocarbonate Chemical compound CCOC(=O)OC(=O)OCC FFYPMLJYZAEMQB-UHFFFAOYSA-N 0.000 description 1
- HPNMFZURTQLUMO-UHFFFAOYSA-N diethylamine Chemical compound CCNCC HPNMFZURTQLUMO-UHFFFAOYSA-N 0.000 description 1
- 229940079919 digestives enzyme preparation Drugs 0.000 description 1
- WDRWZVWLVBXVOI-QTNFYWBSSA-L dipotassium;(2s)-2-aminopentanedioate Chemical compound [K+].[K+].[O-]C(=O)[C@@H](N)CCC([O-])=O WDRWZVWLVBXVOI-QTNFYWBSSA-L 0.000 description 1
- BNIILDVGGAEEIG-UHFFFAOYSA-L disodium hydrogen phosphate Chemical compound [Na+].[Na+].OP([O-])([O-])=O BNIILDVGGAEEIG-UHFFFAOYSA-L 0.000 description 1
- 150000004662 dithiols Chemical group 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 229940000406 drug candidate Drugs 0.000 description 1
- 238000007877 drug screening Methods 0.000 description 1
- 239000012636 effector Substances 0.000 description 1
- 238000001493 electron microscopy Methods 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 238000005538 encapsulation Methods 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 230000009088 enzymatic function Effects 0.000 description 1
- 238000006911 enzymatic reaction Methods 0.000 description 1
- 238000001952 enzyme assay Methods 0.000 description 1
- 238000001976 enzyme digestion Methods 0.000 description 1
- 108010092809 exonuclease Bal 31 Proteins 0.000 description 1
- 239000013613 expression plasmid Substances 0.000 description 1
- 238000000605 extraction Methods 0.000 description 1
- 230000002349 favourable effect Effects 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 239000012737 fresh medium Substances 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- 238000001415 gene therapy Methods 0.000 description 1
- 238000012248 genetic selection Methods 0.000 description 1
- 239000000122 growth hormone Substances 0.000 description 1
- ZJYYHGLJYGJLLN-UHFFFAOYSA-N guanidinium thiocyanate Chemical compound SC#N.NC(N)=N ZJYYHGLJYGJLLN-UHFFFAOYSA-N 0.000 description 1
- 238000003306 harvesting Methods 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- 230000007062 hydrolysis Effects 0.000 description 1
- 238000006460 hydrolysis reaction Methods 0.000 description 1
- 230000008073 immune recognition Effects 0.000 description 1
- 238000003018 immunoassay Methods 0.000 description 1
- 238000003119 immunoblot Methods 0.000 description 1
- 230000000984 immunochemical effect Effects 0.000 description 1
- 230000001506 immunosuppresive effect Effects 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 230000000968 intestinal effect Effects 0.000 description 1
- 210000000936 intestine Anatomy 0.000 description 1
- JEIPFZHSYJVQDO-UHFFFAOYSA-N iron(III) oxide Inorganic materials O=[Fe]O[Fe]=O JEIPFZHSYJVQDO-UHFFFAOYSA-N 0.000 description 1
- YOBAEOGBNPPUQV-UHFFFAOYSA-N iron;trihydrate Chemical compound O.O.O.[Fe].[Fe] YOBAEOGBNPPUQV-UHFFFAOYSA-N 0.000 description 1
- 108010045069 keyhole-limpet hemocyanin Proteins 0.000 description 1
- 101150066555 lacZ gene Proteins 0.000 description 1
- 210000000265 leukocyte Anatomy 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 238000009630 liquid culture Methods 0.000 description 1
- 230000033001 locomotion Effects 0.000 description 1
- UEGPKNKPLBYCNK-UHFFFAOYSA-L magnesium acetate Chemical compound [Mg+2].CC([O-])=O.CC([O-])=O UEGPKNKPLBYCNK-UHFFFAOYSA-L 0.000 description 1
- 239000011654 magnesium acetate Substances 0.000 description 1
- 235000011285 magnesium acetate Nutrition 0.000 description 1
- 229940069446 magnesium acetate Drugs 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- 101150003180 metB gene Proteins 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- 102000035118 modified proteins Human genes 0.000 description 1
- 108091005573 modified proteins Proteins 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- XONPDZSGENTBNJ-UHFFFAOYSA-N molecular hydrogen;sodium Chemical compound [Na].[H][H] XONPDZSGENTBNJ-UHFFFAOYSA-N 0.000 description 1
- 235000013919 monopotassium glutamate Nutrition 0.000 description 1
- 230000000869 mutational effect Effects 0.000 description 1
- VVEKAPJMXBKPAP-UHFFFAOYSA-N n'-[3-(2,4-dinitroanilino)propyl]-n'-methylpropane-1,3-diamine Chemical compound NCCCN(C)CCCNC1=CC=C([N+]([O-])=O)C=C1[N+]([O-])=O VVEKAPJMXBKPAP-UHFFFAOYSA-N 0.000 description 1
- 229930014626 natural product Natural products 0.000 description 1
- 238000006386 neutralization reaction Methods 0.000 description 1
- 102000044158 nucleic acid binding protein Human genes 0.000 description 1
- 108700020942 nucleic acid binding protein Proteins 0.000 description 1
- 239000002751 oligonucleotide probe Substances 0.000 description 1
- 238000002515 oligonucleotide synthesis Methods 0.000 description 1
- 229940092253 ovalbumin Drugs 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 108700010839 phage proteins Proteins 0.000 description 1
- 101150034875 phoA2 gene Proteins 0.000 description 1
- 102000020233 phosphotransferase Human genes 0.000 description 1
- 230000000704 physical effect Effects 0.000 description 1
- 238000000053 physical method Methods 0.000 description 1
- 108010024226 placental ribonuclease inhibitor Proteins 0.000 description 1
- 239000013600 plasmid vector Substances 0.000 description 1
- 229920003023 plastic Polymers 0.000 description 1
- 239000004033 plastic Substances 0.000 description 1
- 229920001155 polypropylene Polymers 0.000 description 1
- 229920002981 polyvinylidene fluoride Polymers 0.000 description 1
- 239000002987 primer (paints) Substances 0.000 description 1
- 230000037452 priming Effects 0.000 description 1
- 230000000644 propagated effect Effects 0.000 description 1
- 230000000069 prophylactic effect Effects 0.000 description 1
- 238000001243 protein synthesis Methods 0.000 description 1
- 230000002797 proteolythic effect Effects 0.000 description 1
- 230000000171 quenching effect Effects 0.000 description 1
- 238000009790 rate-determining step (RDS) Methods 0.000 description 1
- 230000009257 reactivity Effects 0.000 description 1
- GKBMIFPNPOSTHB-BJBKLNMKSA-N recombinant soluble cd4 Chemical compound NC(=O)C[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CS)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(O)=O GKBMIFPNPOSTHB-BJBKLNMKSA-N 0.000 description 1
- 239000011347 resin Substances 0.000 description 1
- 229920005989 resin Polymers 0.000 description 1
- 102220080600 rs797046116 Human genes 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 229920006298 saran Polymers 0.000 description 1
- 229920006395 saturated elastomer Polymers 0.000 description 1
- 238000004062 sedimentation Methods 0.000 description 1
- 238000010187 selection method Methods 0.000 description 1
- 239000006152 selective media Substances 0.000 description 1
- 239000012679 serum free medium Substances 0.000 description 1
- 239000001632 sodium acetate Substances 0.000 description 1
- 235000017281 sodium acetate Nutrition 0.000 description 1
- NLJMYIDDQXHKNR-UHFFFAOYSA-K sodium citrate Chemical compound O.O.[Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O NLJMYIDDQXHKNR-UHFFFAOYSA-K 0.000 description 1
- 235000011083 sodium citrates Nutrition 0.000 description 1
- FQENQNTWSFEDLI-UHFFFAOYSA-J sodium diphosphate Chemical compound [Na+].[Na+].[Na+].[Na+].[O-]P([O-])(=O)OP([O-])([O-])=O FQENQNTWSFEDLI-UHFFFAOYSA-J 0.000 description 1
- 239000012064 sodium phosphate buffer Substances 0.000 description 1
- 229940048086 sodium pyrophosphate Drugs 0.000 description 1
- 125000006850 spacer group Chemical group 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 238000001228 spectrum Methods 0.000 description 1
- 229940063673 spermidine Drugs 0.000 description 1
- 239000008223 sterile water Substances 0.000 description 1
- 239000011550 stock solution Substances 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 1
- 235000019818 tetrasodium diphosphate Nutrition 0.000 description 1
- 239000001577 tetrasodium phosphonato phosphate Substances 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 229960004072 thrombin Drugs 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 238000010361 transduction Methods 0.000 description 1
- 230000026683 transduction Effects 0.000 description 1
- 239000001226 triphosphate Substances 0.000 description 1
- 235000011178 triphosphate Nutrition 0.000 description 1
- UNXRWKVEANCORM-UHFFFAOYSA-N triphosphoric acid Chemical compound OP(O)(=O)OP(O)(=O)OP(O)(O)=O UNXRWKVEANCORM-UHFFFAOYSA-N 0.000 description 1
- HRXKRNGNAMMEHJ-UHFFFAOYSA-K trisodium citrate Chemical compound [Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O HRXKRNGNAMMEHJ-UHFFFAOYSA-K 0.000 description 1
- 235000019263 trisodium citrate Nutrition 0.000 description 1
- 229940038773 trisodium citrate Drugs 0.000 description 1
- 239000002753 trypsin inhibitor Substances 0.000 description 1
- 239000012137 tryptone Substances 0.000 description 1
- 210000004881 tumor cell Anatomy 0.000 description 1
- 230000007306 turnover Effects 0.000 description 1
- 108010087967 type I signal peptidase Proteins 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- 238000009281 ultraviolet germicidal irradiation Methods 0.000 description 1
- 241000701447 unidentified baculovirus Species 0.000 description 1
- 108700026220 vif Genes Proteins 0.000 description 1
- 238000012800 visualization Methods 0.000 description 1
- 239000012138 yeast extract Substances 0.000 description 1
- 239000011592 zinc chloride Substances 0.000 description 1
- JIAARYAFYJHUJI-UHFFFAOYSA-L zinc dichloride Chemical compound [Cl-].[Cl-].[Zn+2] JIAARYAFYJHUJI-UHFFFAOYSA-L 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/005—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies constructed by phage libraries
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/26—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against hormones ; against hormone releasing or inhibiting factors
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/34—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against blood group antigens
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/40—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against enzymes
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/44—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material not provided for elsewhere, e.g. haptens, metals, DNA, RNA, amino acids
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/46—Hybrid immunoglobulins
- C07K16/461—Igs containing Ig-regions, -domains or -residues form different species
- C07K16/462—Igs containing a variable region (Fv) from one specie and a constant region (Fc) from another
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/46—Hybrid immunoglobulins
- C07K16/468—Immunoglobulins having two or more different antigen binding sites, e.g. multifunctional antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K19/00—Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
- C12N15/1034—Isolating an individual clone by screening libraries
- C12N15/1037—Screening libraries presented on the surface of microorganisms, e.g. phage display, E. coli display
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/62—DNA sequences coding for fusion proteins
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/70—Vectors or expression systems specially adapted for E. coli
- C12N15/73—Expression systems using phage (lambda) regulatory sequences
-
- C—CHEMISTRY; METALLURGY
- C40—COMBINATORIAL TECHNOLOGY
- C40B—COMBINATORIAL CHEMISTRY; LIBRARIES, e.g. CHEMICAL LIBRARIES
- C40B40/00—Libraries per se, e.g. arrays, mixtures
- C40B40/02—Libraries contained in or displayed by microorganisms, e.g. bacteria or animal cells; Libraries contained in or displayed by vectors, e.g. plasmids; Libraries containing only microorganisms or vectors
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6854—Immunoglobulins
- G01N33/6857—Antibody fragments
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B01—PHYSICAL OR CHEMICAL PROCESSES OR APPARATUS IN GENERAL
- B01J—CHEMICAL OR PHYSICAL PROCESSES, e.g. CATALYSIS OR COLLOID CHEMISTRY; THEIR RELEVANT APPARATUS
- B01J2219/00—Chemical, physical or physico-chemical processes in general; Their relevant apparatus
- B01J2219/00274—Sequential or parallel reactions; Apparatus and devices for combinatorial chemistry or for making arrays; Chemical library technology
- B01J2219/00718—Type of compounds synthesised
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/40—Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation
- C07K2319/41—Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation containing a Myc-tag
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/70—Fusion polypeptide containing domain for protein-protein interaction
- C07K2319/735—Fusion polypeptide containing domain for protein-protein interaction containing a domain for self-assembly, e.g. a viral coat protein (includes phage display)
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y10—TECHNICAL SUBJECTS COVERED BY FORMER USPC
- Y10S—TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y10S530/00—Chemistry: natural resins or derivatives; peptides or proteins; lignins or reaction products thereof
- Y10S530/867—Chemistry: natural resins or derivatives; peptides or proteins; lignins or reaction products thereof involving immunoglobulin or antibody produced via recombinant dna technology
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Genetics & Genomics (AREA)
- Immunology (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Biophysics (AREA)
- Medicinal Chemistry (AREA)
- Biomedical Technology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biotechnology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- Microbiology (AREA)
- General Engineering & Computer Science (AREA)
- Physics & Mathematics (AREA)
- Hematology (AREA)
- Urology & Nephrology (AREA)
- Plant Pathology (AREA)
- Virology (AREA)
- Cell Biology (AREA)
- Food Science & Technology (AREA)
- Analytical Chemistry (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Endocrinology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Crystallography & Structural Chemistry (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Peptides Or Proteins (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Materials For Medical Uses (AREA)
- Seal Device For Vehicle (AREA)
- Medicinal Preparation (AREA)
Abstract
A member of a specific binding pair (sbp) is identified by expressing DNA encoding a genetically diverse population of such sbp members in recombinant host cells in which the sbp members are displayed in functional form at the surface of a secreted recombinant genetic display package (rgdp) containing DNA encoding the sbp member or a polypeptide component thereof, by virtue of the sbp member or a polypeptide component thereof being expressed as a fusion with a capsid component of the rgdp. The displayed sbps may be selected by affinity with a complementary sbp member, and the DNA recovered from selected rgdps for expression of the selected sbp members. Antibody sbp members may be thus obtained, with the different chains thereof expressed, one fused to the capsid component and the other in free form for association with the fusion partner polypeptide. A phagemid may be used as an expression vector, with said capsid fusion helping to package the phagemid DNA. Using this method libraries of DNA encoding respective chains of such multimeric sbp members may be combined, thereby obtaining a much greater genetic diversity in the sbp members than could easily be obtained by conventional methods.
Description
- This application is a continuation of U.S. Ser. No. 09/417,479, (filed on Oct. 13, 1999), which is a division of U.S. Ser. No. 08/484,893 (now U.S. Pat. No. 6,172,197), filed on Jun. 7, 1995, which is a continuation of U.S. Ser. No. 07/971,857 (now U.S. Pat. No. 5,969,108) filed on Jan. 8, 1993, which is a U.S. National Stage of PCT/GB91/01134 filed on Jul. 10, 1991, which claims priority to U.K. Applications 9015198.6 (filed Jul. 10, 1990), 9022845.3 (filed Oct. 19, 1990), 9024503.6 (filed Nov. 20, 1990), 9104744.9 (filed Mar. 6, 1991), and 9110549.4 (filed May 15, 1991). Each of these applications is hereby incorporated by reference herein.
- The present invention relates to methods for producing members of specific binding pairs. The present invention also relates to the biological binding molecules produced by these methods. Owing to their high specificity for a given antigen, the advent of monoclonal antibodies (Kohler, G. and Milstein C; 1975 Nature 256: 495) represented a significant technical break-through with important consequences both scientifically and commercially. Monoclonal antibodies are traditionally made by establishing an immortal mammalian cell line which is derived from a single immunoglobulin producing cell secreting one form of a biologically functional antibody molecule with a particular specificity. Because the antibody-secreting mammalian cell line is immortal, the characteristics of the antibody are reproducible from batch to batch. The key properties of monoclonal antibodies are their specificity for a particular antigen and the reproducibility with which they can be manufactured.
- Structurally, the simplest antibody (IgG) comprises four polypeptide chains, two heavy (H) chains and two light (L) chains inter-connected by disulphide bonds (see
FIG. 1 ). The light chains exist in two distinct forms called kappa (K) and lambda (λ). Each chain has a constant region (C) and a variable region (V). Each chain is organized into a series of domains. The light chains have two domains, corresponding to the C region and the other to the V region. The heavy chains have four domains, one corresponding to the V region and three domains (1, 2 and 3) in the C region. The antibody has two arms (each arm being a Fab region), each of which has a VL and a VH region associated with each other. It is this pair of v regions (VL and VH) that differ from one antibody to another (owing to amino acid sequence variations), and which together are responsible for recognising the antigen and providing an antigen binding site (ABS). In even more detail, each V region is made up from three complementarity determining regions (CDR) separated by four framework regions (FR). The CDR's are the most variable part of the variable regions, and they perform the critical antigen binding function. The CDR regions are derived from many potential germ line sequences via a complex process involving recombination, mutation and selection. - It has been shown that the function of binding antigens can be performed by fragments of a whole antibody. Example binding fragments are (i) the Fab fragment consisting of the VL, VH, CL and CH1 domains; (ii) the Fd fragment consisting of the VH and CH1 domains; (iii) the Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (iv) the dAb fragment (Ward, E. S. et al., Nature 341, 544-546 (1989) which consists of a VH domain; (v) isolated CDR regions; and (vi) F(ab′)2 fragments, a bivalent fragment comprising two Fab fragments linked by a disulphide bridge at the hinge region.
- Although the two domains of the Fv fragment are coded for by separate genes, it has proved possible to make a synthetic linker that enables them to be made as a single protein chain (known as single chain Fv (scFv); Bird, R. E. et al., Science 242, 423-426 (1988) Huston, J. S. et al., Proc. Natl. Acad. Sci., USA 85, 5879-5883 (1988)) by recombinant methods. These scFv fragments were assembled from genes from monoclonals that had been previously isolated. In this application, the applicants describe a process to assemble scFv fragments from VH and VL domains that are not part of an antibody that has been previously isolated.
- Whilst monoclonal antibodies, their fragments and derivatives have been enormously advantageous, there are nevertheless a number of limitations associated with them.
- Firstly, the therapeutic applications of monoclonal antibodies produced by human immortal cell lines holds great promise for the treatment of a wide range of diseases (Clinical Applications of Monoclonal Antibodies. Edited by E. S. Lennox. British Medical Bulletin 1984. Publishers Churchill Livingstone). Unfortunately, immortal antibody-producing human cell lines are very difficult to establish and they give low yields of antibody (approximately 1 μg/ml). In contrast, equivalent rodent cell lines yield high amounts of antibody (approximately 100 μg/ml). However, the repeated administration of these foreign rodent proteins to humans can lead to harmful hypersensitivity reactions. In the main therefore, these rodent-derived monoclonal antibodies have limited therapeutic use.
- Secondly, a key aspect in the isolation of monoclonal antibodies is how many different clones of antibody producing cells with different specificities, can be practically established and sampled compared to how many theoretically need to be sampled in order to isolate a cell producing antibody with the desired specificity characteristics (Milstein, C., Royal Soc. Croonian Lecture, Proc. R. Soc. London B. 239; 1-16, (1990)). For example, the number of different specificities expressed at any one time by lymphocytes of the murine immune system is thought to be approximately 107 and this is only a small proportion of the potential repertoire of specificities. However, during the isolation of a typical antibody producing cell with a desired specificity, the investigator is only able to sample 103 to 104 individual specificities. The problem is worse in the human, where one has approximately 1012 lymphocyte specificities, with the limitation on sampling of 103 or 104 remaining.
- This problem has been alleviated to some extent in laboratory animals by the use of immunisation regimes. Thus, where one wants to produce monoclonal antibodies having a specificity against a particular epitope, an animal is immunised with an immunogen expressing that epitope. The animal will then mount an immune response against the immunogen and there will be a proliferation of lymphocytes which have specificity against the epitope. Owing to this proliferation of lymphocytes with the desired specificity, it becomes easier to detect them in the sampling procedure. However, this approach is not successful in all cases, as a suitable immunogen may not be available. Furthermore, where one wants to produce human monoclonal antibodies (e.g., for therapeutic administration as previously discussed), such an approach is not practically, or ethically, feasible.
- In the last few years, these problems have in part, been addressed by the application of recombinant DNA methods to the isolation and production of, e.g., antibodies and fragments of antibodies with antigen binding ability, in bacteria such as E. coli.
- This simple substitution of immortalised cells with bacterial cells as the ‘factory’, considerably simplifies procedures for preparing large amounts of binding molecules. Furthermore, a recombinant production system allows scope for producing tailor-made antibodies and fragments thereof. For example, it is possible to produce chimeric molecules with new combinations of binding and effector functions, humanised antibodies (e.g., murine variable regions combined with human constant domains or murine-antibody CDRs grafted onto a human FR) and novel antigen-binding molecules. Furthermore, the use of polymerase chain reaction (PCR) amplification (Saiki, R. K., et al., Science 239, 487-491 (1988)) to isolate antibody producing sequences from cells (e.g., hybridomas and B cells) has great potential for speeding up the timescale under which specificities can be isolated. Amplified VH and VL genes are cloned directly into vectors for expression in bacteria or mammalian cells (Orlandi, R., et al., 1989, Proc. Natl. Acad. Sci., USA 86, 3833-3837; Ward, E. S., et al., 1989 supra; Larrick, J. W., et al., 1989, Biochem. Biophys. Res. Commun. 160, 1250-1255; Sastry, L. et al., 1989, Proc. Natl. Acad. Sci., USA., 86, 5728-5732). Soluble antibody fragments secreted from bacteria are then screened for binding activities.
- However, like the production system based upon immortalised cells, the recombinant production system still suffers from the selection problems previously discussed and therefore relies on animal immunization to increase the proportion of cells with desired specificity. Furthermore, some of these techniques can exacerbate the screening problems. For example, large separate H and L chain libraries have been produced from immunized mice and combined together in a random combinatorial manner prior to screening (Huse, W. D. et al., 1989, Science 246, 1275-1281, WO90/14443; WO90/14424 and WO90/14430). Crucially, however, the information held within each cell, namely the original pairing of one L chain with one H chain, is lost. This loses some, of the advantage gained by using immunization protocols in the animal. Currently, only libraries derived from single VH domains (dAbs; Ward, E. S., et al., 1989, supra.) do not suffer this drawback. However, because not all antibody VH domains are capable of binding antigen, more have to be screened. In addition, the problem of directly screening many different specificities in prokaryotes remains to be solved.
- Thus, there is a need for a screening system which ameliorates or overcomes one or more of the above or other problems. The ideal system would allow the sampling of very large numbers of specificities (e.g., 106 and higher), rapid sorting at each cloning round, and rapid transfer of the genetic material coding for the binding molecule from one stage of the production process, to the next stage.
- The most attractive candidates for this type of screening, would be prokaryotic organisms (because they grow quickly, are relatively simple to manipulate and because large numbers of clones can be created) which express and display at their surface a functional binding domain, e.g., an antibody, receptor, enzyme, etc. In the UK patent GB 2137631B methods for the co-expression in a single host cell of the variable H and L chain genes of immunoglobulins were disclosed. However, the protein was expressed intracellularly and was insoluble. Further, the protein required extensive processing to generate antibody fragments with binding activity and this generated material with only a fraction of the binding activity expected for antibody fragments at this concentration. It has already been shown that antibody fragments can be secreted through bacterial membranes with the appropriate signal peptide (Skerra, A. and Pluckthun, A. 1988
Science 240 1038-1040; Better, M et al 1988,Science 240 1041-1043) with a consequent increase in the binding activity of antibody fragments. These methods require screening of individual clones for binding activity in the same way as do mouse monoclonal antibodies. - It has not been shown however, how a functional binding domain, e.g., an antibody, antibody fragment, receptor, enzyme, etc., can be held on the bacterial surface in a configuration which allows sampling of say its antigen binding properties and selection for clones with desirable properties. In large part, this is because the bacterial surface is a complex structure, and in the gram-negative organisms there is an outer wall which further complicates the position. Further, it has not been shown that, e.g., an antibody domain will fold correctly when expressed as a fusion with a surface protein of bacteria or bacteriophage.
- Bacteriophage are attractive prokaryote related organisms for this type of screening. In general, their surface is a relatively simple structure, they can be grown easily in large numbers, they are amenable to the practical handling involved in many potential mass screening programmes, and they carry genetic information for their own synthesis within a small, simple package. The difficulty has been to practically solve the problem of how to use bacteriophages in this manner. A Genex Corporation patent application number WO88/06630 has proposed that the bacteriophage lambda would be a suitable vehicle for the expression of antibody molecules, but they do not provide a teaching which enables the general idea to be carried out.
- For example, WO88/06630 does not demonstrate that any sequences: (a) have been expressed as a fusion with gene V; (b) have been expressed on the surface of lambda; and (c) have been expressed so that the protein retains biological activity. Furthermore there is no teaching on how to screen for suitable fusions. Also, since the lambda virions are assembled within the cell, the fusion protein would be expressed intracellularly and would be predicted to be inactive. Bass et al., in December 1990 (after the earliest priority date for the present application) describe deleting part of gene III of the filamentous bacteriophage M13 and inserting the coding sequence for human growth hormone (hGH) into the N-terminal site of the gene. The growth hormone displayed by M13 was shown to be functional. (Bass, S., et al. Proteins, Structure, Function and Genetics (1990) 8: 309-314). A functional copy of gene III was always present in addition, when this fusion was expressed. A Protein Engineering Corporation patent application WO90/02809 proposes the insertion of the coding sequence for bovine pancreatic trypsin inhibitor (BPTI) into gene VIII of M13. However, the proposal was not shown to be operative. For example, there is no demonstration of the expression of BPTI sequences as fusions with protein VIII and display on the surface of M13. Furthermore this document teaches that when a fusion is made with gene III, it is necessary to use a second synthetic copy of gene III, so that some unaltered gene III protein will be present. The embodiments of the present application do not do this. In embodiments where phagemid is rescued with M13K07 gene III deletion phage, there is no unaltered gene III present.
- WO90/02809 also teaches that phagemids that do not contain the full genome of M13 and require rescue by coinfection with helper phage are not suitable for these purposes because coinfection could lead to recombination.
- In all embodiments where the present applicants have used phagemids, they have used a helper phage and the only sequences derived from filamentous bacteriophage in the phagemids are the origin of replication and gene III sequences.
- WO90/02809 also teaches that their process needed information such as nucleotide sequence of the starting molecule and its three-dimensional structure. The use of a pre-existing repertoire of binding molecules to select for a binding member, such as is disclosed herein, for example, using an immunoglobulin gene repertoire of animals, was not disclosed. Further, they do not discuss favouring variegation of their binding molecules in natural blocks of variation such as CDRs of immunoglobulins, in order to favour generation of improved molecules and prevent unfavourable variations. WO90/02809 also specifically excluded the application of their process to the production of scFv molecules.
- In each of the above discussed patents (WO88/06630 and WO90/02809), the protein proposed for display is a single polypeptide chain. There is no disclosure of a method for the display of a dimeric molecule by expression of one monomer as a fusion with a capsid protein and the other protein in a free form.
- Another disclosure published in May 1991 (after the earliest priority date for the present application) describes the insertion into gene VIII of M13, the coding sequences for one of the two chains of the Fab portion of an antibody with co-expression of the other from a plasmid.
- The two chains were demonstrated as being expressed as a functional Fab fragment on the surface of the phage (Kang A. S. et al., (1991) Proc. Natl. Acad. Sci, USA, 88 p 4363-4366). No disclosure was made of the site of insertion into gene VIII and the assay for pAb binding activity by ELISA used a reagent specific for antibody L chain rather than for phage. A further disclosure published in March 1991 (after the earliest priority date for the present application) describes the insertion of a fragment of the AIDS virus protein gag into the N-terminal portion of gene III of the bacteriophage fd. The expression of the gag protein fragment was detected by immunological methods, but it was not shown whether or not the protein was expressed in a functional form (Tsunetsugu-Yokota Y et al. (1991) Gene 99 p 261-265).
- The problem of how to use bacteriophages in this way is in fact a difficult one. The protein must be inserted into the phage in such a way that the integrity of the phage coat is not undermined, and the protein itself should be functional retaining its biological activity with respect to antigen binding. Thus, where the protein of choice is an antibody, it should fold efficiently and correctly and be presented for antigen binding. Solving the problem for antibody molecules and fragments would also provide a general method for any biomolecule which is a member of a specific binding pair, e.g., receptor molecules and enzymes.
- Surprisingly, the applicants have been able to construct a bacteriophage that expresses and displays at its surface a large biologically functional binding molecule (e.g., antibody fragments, and enzymes and receptors) and which remains intact and infectious. The applicants have called the structure which comprises a virus particle and a binding molecule displayed at the viral surface a ‘package’. Where the binding molecule is an antibody, an antibody derivative or fragment, or a domain that is homologous to an immunoglobulin domain, the applicants call the package a ‘phage antibody’ (pAb). However, except where the context demands otherwise, where the term phage antibody is used generally, it should also be interpreted as referring to any package comprising a virus particle and a biologically functional binding molecule displayed at the viral surface.
- pAbs have a range of applications in selecting antibody genes encoding antigen binding activities. For example, pAbs could be used for the cloning and rescue of hybridomas (Orlandi, R., et al (1989) PNAS 86 p 3833-3837), and in the screening of large combinatorial libraries (such as found in Huse, W. D. et al., 1989,
Science 246, 1275-1281). In particular, rounds of selection using pAbs may help in rescuing the higher affinity antibodies from the latter libraries. It may be preferable to screen small libraries derived from antigen-selected cells (Casali, P., et al., (1986) Science 234 p 476-479) to rescue the original VH/VL pairs comprising the Fv region of an antibody. The use of pAbs may also allow the construction of entirely synthetic antibodies. Furthermore, antibodies may be made which have some synthetic sequences, e.g., CDRs, and some naturally derived sequences. For example, V-gene repertoires could be made in vitro by combining un-rearranged V genes, with D and J segments. Libraries of pAbs could then be selected by binding to antigen, hypermutated in vitro in the antigen-binding loops or V domain framework regions, and subjected to further rounds of selection and mutagenesis. - As previously discussed, separate H and L chain libraries lose the original pairing between the chains. It is difficult to make and screen a large enough library for a particularly advantageous combination of H and L chains.
- For example, in a mouse there are approximately 107 possible H chains and 107 possible L chains. Therefore, there are 1014 possible combinations of H and L chains, and to test for anything like this number of combinations one would have to create and screen a library of about 1014 clones. This has not previously been a practical possibility.
- The present invention provides a number of approaches which ameliorate this problem.
- In a first approach, (a random combinatorial approach, see examples 20 and 21) as large a library as is practically possible is created which expresses as many of the 1014 potential combinations as possible. However, by virtue of the expression of the H and L chains on the surface of the phage, it is reasonably practicable to select the desired combination, from all the generated combinations by affinity techniques (see later for description of selection formats).
- In a second approach (called a dual combinatorial approach by the present applicants, see example 26), a large library is created from two smaller libraries for selection of the desired combination. This ameliorates the problems still further. The approach involves the creation of: (i) a first library of
say 107, e.g., H chains which are displayed on a bacteriophage (as a fusion with the protein encoded by gene III) which is resistant to, e.g., tetracycline; and (ii) a second library ofsay 107, e.g., L chains in which the coding sequences for these light chains are within a plasmid vector containing an origin of replication for a bacteriophage (a phagemid) which is resistant to, e.g., ampicillin (i.e., a different antibiotic) and are expressed in the periplasmic space of a host bacterium. The first library is then used to infect the bacteria containing the second library to provide 1014 combinations of H and L chains on the surface of the resulting phage in the bacterial supernatant. - The advantage of this approach is that two separate libraries of, e.g., 107 are created in order to produce 1014 combinations. Creating a 107 library is a practical possibility.
- The 1014 combinations are then subjected to selection (see later for description of selection formats) as disclosed by the present application. This selection will then produce a population of phages displaying a particular combination of H and L chains having the desired specificity. The phages selected, however, will only contain DNA encoding one partner of the paired H and L chains (deriving from either the phage or phagemid). The sample eluate containing the population is then divided into two portions. A first portion is grown on, e.g., tetracycline plates to select those bacteriophage containing DNA encoding H chains which are involved in the desired antigen binding. A second portion is grown on, e.g., ampicillin plates to select those bacteriophage containing phagemid DNA encoding L chains which are involved in the desired antigen binding. A set of colonies from individually isolated clones, e.g., from the tetracycline plates are then used to infect specific colonies, e.g., from the ampicillin plates. This results in bacteriophage expressing specific combinations of H and L chains which can then be assayed for antigen binding.
- In a third approach (called a hierarchical dual combinational approach by the present applicants), an individual colony from either the H or L chain clone selected by growth on the antibiotic plates, is used to infect a complete library of clones encoding the other chain (H or L). Selection is as described above. This favours isolation of the most favourable combination.
- In a fourth approach (called a hierarchrical approach by the present applicants, see examples 22 and 46) both chains are cloned into the same vector. However, one of the chains which is already known to have desirable properties is kept fixed. A library of the complementary chain is inserted into the same vector. Suitable partners for the fixed chain are selected following display on the surface of bacteriophage.
- In a fifth approach (see example 48), to improve the chances of recovering original pairs, the complexity of the combinatorial libraries can be reduced by using small B populations of B-lymphocytes selected for binding to a desired antigen. The cells provide, e.g., mRNA or DNA, for preparing libraries of antibody genes for display on phage. This technique can be used in combination with the above mentioned four approaches for selection of antibody specificities.
- Phagemids have been mentioned above. The applicants have realised and demonstrated that in many cases phagemids will be preferred to phage for cloning antibodies because it is easier to use them to generate more comprehensive libraries of the immune repertoire. This is because the phagemid DNA is approximately 100 times more efficient than bacteriophage DNA in transforming bacteria (see example 19). Also, the use of phagemids gives the ability to vary the number of gene III binding molecule fusion proteins displayed on the surface of the bacteriophage (see example 17). For example, in a system comprising a bacterial cell containing a phagemid encoding a gene III fusion protein and infected with a helper phage, induction of expression of the gene III fusion protein to different extents, will determine the number of gene III fusion proteins present in the space defined between the inner and outer bacterial membranes following superinfection. This will determine the ratio of gene III fusion protein to native gene III protein displayed by the assembled phage.
- Expressing a single fusion protein per virion may aid selection of antibody specificities on the basis of affinity by avoiding the ‘avidity’ effect where a phage expressing two copies of a low affinity antibody would have the same apparent affinity as a phage expressing one copy of a higher affinity antibody. In some cases however, it will be important to display all the gene III molecules derived by superinfection of cells containing phagemids to have fusions (e.g., for selecting low affinity binding molecules or improving sensitivity on ELISA). One way to do this is to superinfect with a bacteriophage which contains a defective gene III. The applicants have, therefore, developed and used a phage which is deleted in gene III. This is completely novel.
- The demonstration that a functional antigen-binding domain can be displayed on the surface of phage, has implications beyond the construction of novel antibodies. For example, if other protein domains can be displayed at the surface of a phage, phage vectors could be used to clone and select genes by the binding properties of the displayed protein. Furthermore, variants of proteins, including epitope libraries built into the surface of the protein, could be made and readily selected for binding activities. In effect, other protein architectures might serve as “nouvelle” antibodies.
- The technique provides the possibility of building antibodies from first principles, taking advantage of the structural framework on which the antigen binding loops fold. In general, these loops have a limited number of conformations which generate a variety of binding sites by alternative loop combinations and by diverse side chains. Recent successes in modelling antigen binding sites augurs well for de novo design. In any case, a high resolution structure of the antigen is needed. However, the approach is attractive for making, e.g., catalytic antibodies, particularly for small substrates. Here side chains or binding sites for prosthetic groups might be introduced, not only to bind selectively to the transition state of the substrate, but also to participate directly in bond making and breaking. The only question is whether the antibody architecture, specialised for binding, is the best starting point for building catalysts. Genuine enzyme architectures, such as the triose phosphate isomerase (TIM) barrel, might be more suitable. Like antibodies, TIM enzymes also have a framework structure (a barrel of β-strands and α-helices) and loops to bind substrate. Many enzymes with a diversity of catalytic properties are based on this architecture and the loops might be manipulated independently on the frameworks for design of new catalytic and binding properties. The phage selection system as provided by the present disclosure can be used to select for antigen binding activities and the CDR loops thus selected, used on either an antibody framework or a TIM barrel framework. Loops placed on a, e.g., a TIM barrel framework could be further modified by mutagenesis and subjected to further selection. Thus, there is no need to select for high affinity binding activities in a single step. The strategy of the immune system, in which low affinity evolves to high affinity seems more realistic and can be mimicked using this invention.
- One class of molecules that could be useful in this type of application are receptors. For example, a specific receptor could be displayed on the surface of the phage such that it would bind its ligand. The receptor could then be modified by, for example, in vitro mutagenesis and variants having higher binding affinity for the ligand selected. The selection may be carried out according to one or more of the formats described below with reference to
FIG. 2 (which refers particularly to pAbs) in which the pAb antibody is replaced with a phage receptor and the antigen with aligand 1. - Alternatively, the phage-receptor could be used as the basis of a rapid screening system for the binding of ligands, altered ligands, or potential drug candidates. The advantages of this system namely of simple cloning, convenient expression, standard reagents and easy handling makes the drug screening application particularly attractive. In the context of this discussion, receptor means a molecule that binds a specific, or group of specific, ligand(s). The natural receptor could be expressed on the surface of a population of cells, or it could be the extracellular domain of such a molecule (whether such a form exists naturally or not), or a soluble molecule performing a natural binding function in the plasma, or within a cell or organ.
- Another possibility, is the display of an enzyme molecule or active site of an enzyme molecule on the surface of a phage (see examples 11, 12, 30, 31, 32 and 36). Once the phage enzyme is expressed, it can be selected by affinity chromatography, for instance on columns derivatized with transition state analogues. If an enzyme with a different or modified specificity is desired, it may be possible to mutate an enzyme displayed as a fusion on bacteriophage and then select on a column derivatised with an analogue selected to have a higher affinity for an enzyme with the desired modified specificity.
- Although throughout this application, the applicants discuss the possibility of screening for higher affinity variants of pAbs, they recognise that in some applications, for example low affinity chromatography (Ohlson, S. et al Anal. Biochem., 169, pp. 204-208 (1988)), it may be desirable to isolate lower affinity variants.
- Examples 21 and 23 show that the present invention provides a way of producing antibodies with low affinities (as seen in the primary immune response or in unimmunised animals). This is made possible by displaying multiple copies of the antibody on the phage surface in association with gene III protein. Thus, pAbs allow genes for these antibodies to be isolated and if necessary, mutated to provide improved antibodies.
- pAbs also allow the selection of antibodies for improved stability. It has been noted for many antibodies, that yield and stability are improved when the antibodies are expressed at 30° C. rather than 37° C. If pAbs are displayed at 37° C., only those which are stable will be available for affinity selection. When antibodies are to be used in vivo for therapeutic or diagnostic purposes, increased stability would extend the half-life of antibodies in circulation.
- Although stability is important for all antibodies and antibody domains selected using phage, it is particularly important for the selection of Fv fragments which are formed by the non-covalent association of VH and VL fragments. Fv fragments have a tendency to dissociate and have a much reduced half-life in circulation compared to whole antibodies. Fv fragments are displayed on the surface of phage, by the association of one chain expressed as a gene III protein fusion with the complementary chain expressed as a soluble fragment. If pairs of chains have a high tendency to dissociate, they will be much less likely to be selected as pAbs. Therefore, the population will be enriched for pairs which do associate stably. Although dissociation is less of a problem with Fab fragments, selection would also occur for Fab fragments which associate stably. pAbs allow selection for stability to protease attack, only those pAbs that are not cleaved by proteases will be capable of binding their ligand and therefore populations of phage will be enriched for those displaying stable antibody domains.
- The technique of displaying binding molecules on the phage surface can also be used as a primary cloning system. For example, a cDNA library can be constructed and inserted into the bacteriophage and this phage library screened for the ability to bind a ligand. The ligand/binding molecule combination could include any pair of molecules with an ability to specifically bind to one another, e.g., receptor/ligand, enzyme/substrate (or analogue), nucleic acid binding protein/nucleic acid, etc. If one member of the complementary pair is available, this may be a preferred way of isolating a clone for the other member of the pair.
- It will often be necessary to increase the diversity of a population of genes cloned for the display of their proteins on phage or to mutate an individual nucleotide sequence. Although in vitro or in vivo mutagenesis techniques could be used for either purpose, a particularly suitable method would be to use mutator strains. A mutator strain is a strain which contains a genetic defect which causes DNA replicated within it to be mutated with respect to its parent DNA. Hence if a population of genes as gene III fusions is introduced into these strains it will be further diversified and can then be transferred to a non-mutator strain, if desired, for display and selection. Example 38 covers the use of mutator strains with phage antibodies (an example of in vitro mutagenesis and selection of phage antibodies is given in example 45).
- Targeted Gene Transfer
- A useful and novel set of applications makes use of the binding protein on the phage to target the phage genome to a particular cell or group of cells. For example, a pAb specific for a cell surface molecule could be used to bind to the target cell via the surface molecule. The phage could then be internalised, either through the action of the receptor itself or as the result of another event (e.g. an electrical discharge such as in the technique of electroporation). The phage genome would then be expressed if the relevant control signals (for transcription and translation and possibly replication) were present. This would be particularly useful if the phage genome contained a sequence whose expression was desired in the target cell (along with the appropriate expression control sequences). A useful sequence might confer antibiotic resistance to the recipient cell or label the cell by the expression of its product (e.g. if the sequence expressed a detectable gene product such as a luciferase, see White, M, et al, Techniques 2(4), p 194-201 (1990)), or confer a particular property on the target cell (e.g., if the target cell was a tumour cell and the new sequence directed the expression of a tumour suppressing gene), or express an antisense construct designed to turn off a gene or set of genes in the target cell, or a gene or gene product designed to be toxic to the target cell. Alternatively, the sequence whose expression is desired in the target cell can be encoded on a phagemid. The phagemid DNA may then be incorporated into a phage displaying an antibody specific for a cell surface receptor. For example, incorporation may be by superinfection of bacteria containing the phagemid, with a helper phage whose genome encodes the antibody fragment specific for the target cell. The package is then used to direct the phagemid to the target cell.
- This technique of “targeted gene transfer” has a number of uses in research and also in therapy and diagnostics. For example, gene therapy often aims to target the replacement gene to a specific cell type that is deficient in its activity. Targetting pAbs provide a means of achieving this.
- In diagnostics, phage specific for particular bacteria or groups of bacteria have been used to target marker genes, e.g., luciferase, to the bacterial host (sec, for example, Ulitzer, S., and Kuhn, J., EPA 85303913.9). If the host range of the phage is appropriate, only those bacteria that are being tested for, will be infected by the phage, express the luciferase gene and be detected by the light they emit. This system has been used to detect the presence of Salmonella. One major problem with this approach is the initial isolation of a bacteriophage with the correct host range and then the cloning of a luciferase gene cassette into that phage, such that it is functional. The pAb system allows the luciferase cassette to be cloned into a well characterised system (filamentous phage) and allows simple selection of an appropriate host range, by modifying the antibody (or other binding molecule) specificity that the pAb encodes.
- The present applicants have also been able to develop novel selection systems and assay formats which depend on the unique properties of these replicable genetic display packages, e.g., pAbs.
- Terminology
- Much of the terminology discussed in this section has been mentioned in the text where appropriate.
- Specific Binding Pair
- This describes a pair of molecules (each being a member of a specific binding pair) which are naturally derived or synthetically produced. One of the pair of molecules, has an area on its surface, or a cavity which specifically binds to, and is therefore defined as complementary with a particular spatial and polar organisation of the other molecule, so that the pair have the property of binding specifically to each other. Examples of types of specific binding pairs are antigen-antibody, biotin-avidin, hormone-hormone receptor, receptor-ligand, enzyme-substrate, IgG-protein A.
- Multimeric Member
- This describes a first polypeptide which will associate with at least a second polypeptide, when the polypeptides are expressed in free form and/or on the surface of a substrate. The substrate may be provided by a bacteriophage. Where there are two associated polypeptides, the associated polypeptide complex is a dimer, where there are three, a trimer, etc. The dimer, trimer, multimer, etc., or the multimeric member may comprise a member of a specific binding pair.
- Example multimeric members are heavy domains based on an immunoglobulin molecule, light domains based on an immunoglobulin molecule, T-cell receptor subunits.
- Replicable Genetic Display Package (Rgdp)
- This describes a biological particle which has genetic information providing the particle with the ability to replicate. The particle can display on its surface at least part of a polypeptide. The polypeptide can be encoded by genetic information native to the particle and/or artificially placed into the particle or an ancestor of it. The displayed polypeptide may be any member of a specific binding pair e.g., heavy or light chain domains based on an immunoglobulin molecule, an enzyme or a receptor, etc.
- The particle may be a virus e.g., a bacteriophage such as fd or M13.
- Package
- This describes a replicable genetic display package in which the particle is displaying a member of a specific binding pair at its surface. The package may be a bacteriophage which displays an antigen binding domain at its surface. This type of package has been called a phage antibody (pAb).
- Antibody
- This describes an immunoglobulin whether natural or partly or wholly synthetically produced. The term also covers any protein having a binding domain which is homologous to an immunoglobulin binding domain. These proteins can be derived from natural sources, or partly or wholly synthetically produced.
- Example antibodies are the immunoglobulin isotypes and the Fab, F(ab1)2, scFv, Fv, dAb, Fd fragments.
- Immunoglobulin Superfamily
- This describes a family of polypeptides, the members of which have at least one domain with a structure related to that of the variable or constant domain of immunoglobulin molecules. The domain contains two S-sheets and usually a conserved disulphide bond (see A. F. Williams and A. N. Barclay 1988 Ann. Rev Immunol. 6 381-405).
- Example members of an immunoglobulin superfamily are CD4, platelet derived growth factor receptor (PDGFR), intercellular adhesion molecule. (ICAM). Except where the context otherwise dictates, reference to immunoglobulins and immunoglobulin homologs in this application includes members of the immunoglobulin superfamily and homologs thereof.
- Homologs
- This term indicates polypeptides having the same or conserved residues at a corresponding position in their primary, secondary or tertiary structure. The term also extends to two or more nucleotide sequences encoding the homologous polypeptides.
- Example homologous peptides are the immunoglobulin isotypes.
- Functional
- In relation to a sbp member displayed on the surface of a rgdp, means that the sbp member is presented in a folded form in which its specific binding domain for its complementary sbp member is the same or closely analogous to its native configuration, whereby it exhibits similar specificity with respect to the complementary sbp member. In this respect, it differs from the peptides of Smith et al, supra, which do not have a definite folded configuration and can assume a variety of configurations determined by the complementary members with which they may be contacted.
- Genetically Diverse Population
- In connection with sbp members or polypeptide components thereof, this is referring not only to diversity that can exist in the natural population of cells or organisms, but also diversity that can be created by artificial mutation in vitro or in vivo.
- Mutation in vitro may for example, involve random mutagenesis using oligonucleotides having random mutations of the sequence desired to be varied. In vivo mutagenesis may for example, use mutator strains of host microorganisms to harbour the DNA (see Example 38 below).
- Domain
- A domain is a part of a protein that is folded within itself and independently of other parts of the same protein and independently of a complementary binding member.
- Folded Unit
- This is a specific combination of an α-helix and/or β-strand and/or β-turn structure. Domains and folded units contain structures that bring together amino acids that are not adjacent in the primary structure.
- Free Form
- This describes the state of a polypeptide which is not displayed by a replicable genetic display package.
- Conditionally Defective
- This describes a gene which does not express a particular polypeptide under one set of conditions, but expresses it under another set of conditions. An example, is a gene containing an amber mutation expressed in non-suppressing or suppressing hosts respectively.
- Alternatively, a gene may express a protein which is defective under one set of conditions, but not under another set. An example is a gene with a temperature sensitive mutation.
- Suppressible Translational Stop Codon
- This describes a codon which allows the translation of nucleotide sequences downstream of the codon under one set of conditions, but under another set of conditions translation ends at the codon. Example of suppressible translational stop codons are the amber, ochre and opal codons.
- Mutator Strain
- This is a host cell which has a genetic defect which causes DNA replicated within it to be mutated with respect to its parent DNA. Example mutator strains are NR9046mutD5 and NR9046 mut T1 (see Example 38).
- Helper Phage
- This is a phage which is used to infect cells containing a defective phage genome and which functions to complement the defect. The defective phage genome can be a phagemid or a phage with some function encoding gene sequences removed. Examples of helper phages are M13KO7, M13K07 gene III no. 3; and phage displaying or encoding a binding molecule fused to a capsid protein.
- Vector
- This is a DNA molecule, capable of replication in a host organism, into which a gene is inserted to construct a recombinant DNA molecule.
- Phage Vector
- This is a vector derived by modification of a phage genome, containing an origin of replication for a bacteriophage, but not one for a plasmid.
- Phagemid Vector
- This is a vector derived by modification of a plasmid genome, containing an origin of replication for a bacteriophage as well as the plasmid origin of replication.
- Secreted
- This describes a rgdp or molecule that associates with the member of a sbp displayed on the rgdp, in which the sbp member and/or the molecule, have been folded and the package assembled externally to the cellular cytosol.
- Repertoire of Rearranged Immunoglobulin Genes
- A collection of naturally occurring nucleotides, e.g., DNA sequences which encoded expressed immunoglobulin genes in an animal. The sequences are generated by the in vivo rearrangement of, e.g., V, D and J segments for H chains and, e.g., the V and J segments for L chains. Alternatively the sequences may be generated from a cell line immunized in vitro and in which the rearrangement in response to immunization occurs intracellularly.
- Library
- A collection of nucleotide, e.g., DNA, sequences within clones.
- Repertoire of Artificially Rearranged Immunoglobulin Genes
- A collection of nucleotide, e.g., DNA, sequences derived wholly or partly from a source other than the rearranged immunoglobulin sequences from an animal. This may include, for example, DNA sequences encoding VH domains by combining unrearranged V segments with D and J segments and DNA sequences encoding VL domains by combining V and J segments.
- Part or all of the DNA sequences may be derived by oligonucleotide synthesis.
- Secretory Leader Peptide
- This is a sequence of amino acids joined to the N-terminal end of a polypeptide and which directs movement of the polypeptide out of the cytosol.
- Eluant
- This is a solution used to breakdown the linkage between two molecules. The linkage can be a non-covalent or covalent bond(s). The two molecules can be members of a sbp.
- Derivative
- This is a substance which derived from a polypeptide which is encoded by the DNA within a selected rgdp. The derivative polypeptide may differ from the encoded polypeptide by the addition, deletion, substitution or insertion of amino acids, or by the linkage of other molecules to the encoded polypetide. These changes may be made at the nucleotide or protein level. For example, the encoded polypeptide may be a Fab fragment which is then linked to an Fc tail from another source. Alternatively markers such as enzymes, flouresceins, etc., may be linked to, e.g., Fab, scFv fragments.
- The present invention provides a method for producing a replicable genetic display package or population such rgdps of which method comprises the steps of:
- a) inserting a nucleotide sequence encoding a member of a specific binding pair e.g., a binding molecule within a viral genome;
- b) culturing the virus containing said nucleotide sequence, so that said binding molecule is expressed and displayed by the virus at its surface.
- The present invention also provides a method for selecting a rgdp specific for a particular epitope which comprises producing a population of such rgdps as described above and the additional step of selecting for said binding molecule by contacting the population with said epitope so that individual rgdps with the desired specificity may bind to said epitope. The method may comprise one or more of the additional steps of: (i) separating any bound rgdps from the epitope; (ii) recovering any separated rgdps and (iii) using the inserted nucleotide sequences from any separated rgdps in a recombinant system to produce the binding molecule separate from virus. The selection step may isolate the nucleotide sequence encoding the binding molecule of desired specificity, by virtue of said binding molecule being expressed in association with the surface of the virus in which said encoding nucleic acid is contained.
- The present invention also provides a method of producing a multimeric member of a specific binding pair (sbp), which method comprises:
- expressing in a recombinant host organism a first polypeptide chain of said sbp member or a genetically diverse population of said sbp member fused to a component of a secreted replicable genetic display package (rgdp) which thereby displays said polypeptide at the surface of the package, and expressing in a recombinant host organism a second polypeptide chain of said multimer and causing or allowing the polypeptide chains come together to form said multimer as part of said rgdp at least one of said polypeptide chains being expressed from nucleic acid that is capable of being packaged using said component therefor, whereby the genetic material of each said rgdp encodes a said polypeptide chain. Both said chains may be expressed in the same host organism.
- The first and second chains of said multimer may be expressed as separate chains from a single vector containing their respective nucleic acid.
- At least one of said polypeptide chains may be expressed from a phage vector.
- At least one of said polypeptide chains may be expressed from a phagemid vector, the method including using a helper phage, or a plasmid expressing complementing phage genes, to help package said phagemid genome, and said component of the rgdp is a capsid protein therefor. The capsid protein may be absent, defective or conditionally defective in the helper phage.
- The method may comprise introducing a vector capable of expressing said first polypeptide chain, into a host organism which expresses said second polypeptide chain in free form, or introducing a vector capable of expressing said second polypeptide in free form into a host organism which expresses said first polypeptide chain.
- Each of the polypeptide chain may be expressed from nucleic acid which is capable of being packaged as a rgdp using said component fusion product, whereby encoding nucleic acid for both said polypeptide chains are packaged in respective rgdps.
- The nucleic acid encoding at least one of said first and second polypeptide chains may be obtained from a library of nucleic acid including nucleic acid encoding said chain or a population of variants of said chain. Both the first and second polypeptide chains may be obtained from respective said libraries of nucleic acid.
- The present invention also provides a method of producing a member of a specific binding pair (sbp), from a nucleic acid library including nucleic acid encoding said sbp member or a genetically diverse population of said type of sbp members, which method comprises:
-
- expressing in recombinant host cells polypeptides encoded by said library nucleic acid fused to a component of a secreted replicable genetic display package (rgdp) or in free form for association with a polypeptide component of said sbp member which is expressed as a fusion to said rgdp component so that the rgdp displays said sbp member in functional form at the surface of the package, said library nucleic acid being contained within the host cells in a form that is capable of being packaged using said rgdp component, whereby the genetic material of an rgdp displaying an sbp member contains nucleic acid encoding said sbp member or a polypeptide component thereof.
- The nucleotide sequences for the libraries may be derived from, e.g., animal spleen cells or peripheral blood lymphocytes. Alternatively the nucleotide sequence may be derived by the in vitro mutagenesis of an existing antibody coding sequence.
- The present invention also provides a method of producing a member of a specific binding pair (sbp), which method comprises:
-
- expressing in recombinant host cells nucleic acid encoding said sbp member or a genetically diverse population of said type of sbp member wherein the or each said sbp member or a polypeptide component thereof is expressed as a fusion with a component of a secreted replicable genetic display package (rgdp) which displays said sbp member at the surface of the package, nucleic acid encoding said sbp member or a polypeptide component thereof being contained within the host cell in a form that is capable of being packaged using said rgdp component whereby the genetic material of the rgdp displaying said sbp member encodes said sbp member or a polypeptide component thereof, said host organism being a mutator strain which introduces genetic diversity into the sbp member to produce said mixed population.
- The present invention also provides a method of producing a member of a specific binding pair (sbp), which method comprises:
-
- expressing in recombinant host cells nucleic acid encoding said sbp member or a genetically diverse population of said type of sbp member wherein the or each said sbp member or a polypeptide component thereof is expressed as a fusion with a component of a secreted replicable genetic display package (rgdp) which displays said sbp member in functional form at the surface of the package, nucleic acid encoding said sbp member or a polypeptide component thereof being contained within the host cell in a form that is capable of being packaged using said rgdp component whereby the genetic material of the rgdp displaying an sbp member encodes said sbp member or a polypeptide component thereof, said fusions being with bacteriophage capsid protein and the rgdps being formed with said fusions in the absence of said capsid expressed in wild-type form.
- The present invention also provides a method of producing a member of a specific binding pair (sbp) which method comprises:
-
- expressing in recombinant host cells nucleic acid encoding said sbp member or a genetically diverse population of said type of sbp member or a polypeptide component thereof fused to a component of a secreted replicable genetic display package (rgdp) which displays said sbp member in functional form at the surface of the package, nucleic acid encoding said sbp member or a polypeptide component thereof being contained within the host cell in a form that is capable of being packaged using said rgdp component whereby the genetic material of the rgdp displaying an sbp member or a polypeptide component thereof encodes said sbp member or a polypeptide component thereof, said sbp member or polypeptide component thereof being expressed from a phagemid as a capsid fusion, and a helper phage, or a plasmid expressing complementing phage genes, is used along with said capsid fusions to package the phagemid nucleic acid.
- The library or genetically diverse population may be obtained from:
-
- (i) the repertoire of rearranged immunoglobulin genes of an animal immunised with complementary sbp member,
- (ii) the repertoire of rearranged immunoglobulin genes of an animal not immunised with complementary sbp member,
- (iii) a repertoire of artificially rearranged immunoglobulin gene or genes
- (iv) a repertoire of immunoglobulin homolog gene or genes; or
- (v) a mixture of any of (i), (ii), (iii) and (iv).
- The capsid protein may be absent, defective or conditionally defective in the helper phage.
- The host cell may be a mutator strain which introduces genetic diversity into the sbp member nucleic acid.
- The sbp member may comprise a domain which is, or is homologous to, an immunoglobulin domain.
- The rgdp may be a bacteriophage, the host a bacterium, and said component of the rgdp a capsid protein for the bacteriophage. The phage may be a filamentous phage. The phage may be selected from the class I phages fd, M13, f1, If1, lke, ZJ/Z, Ff and the class II phages Xf, Pf1 and Pf3. The phage may be fd or a derivative of fd. The derivative may be tetracycline resistant. The said sbp member or polypeptide chain thereof may be expressed as a fusion with the gene III capsid protein of phage fd or its counterpart in another filamentous phage. The sbp member or polypeptide chain thereof may be inserted in the N-terminal region of the mature capsid protein downstream of a secretory leader peptide. The sequence may be inserted after amino acid +1 of the mature protein. The site for insertion may be flanked by short sequences corresponding to sequences which occur at each end of the nucleic acid to be inserted. For example, where 4 the protein domain is an immunoglobulin domain, the insertion site in the phage may be flanked by nucleotide sequences which code for the first five amino acids and the last five amino acids of the Ig domain. Such flanking nucleotide sequences are shown in
FIGS. 4B and C, wherein the site-flanking nucleotide sequences encode amino acid sequences QVQLQ (SEQ ID NO:1) and VTVSS (SEQ ID NO:2) which occur at either end of the VH domain, or QVQLQ (SEQ ID NO:1) and LEIKR (SEQ ID NO:3) which occur at either end of the Fv (combined VH+VL) domain. Each of these sequences flanking the insertion site may include a suitable cleavage site, as shown inFIG. 4A andFIG. 4B . - Alternatively, the flanking nucleotide sequences shown in
FIGS. 4B and C as described above, may be used to flank the insertion site for any nucleic acid to be inserted, whether or not that nucleic acid codes an immunoglobulin. - The host may be E. coli.
- Nucleic acid encoding an sbp member polypeptide may be linked downstream to a viral capsid protein through a suppressible translational stop codon.
- As previously mentioned, the present invention also provides novel selection systems and assay formats. In these systems and formats, the gene sequence encoding the binding molecule (e.g., the antibody) of desired specificity is separated from a general population of rgdps having a range of specifies, by the fact of its binding to a specific target (e.g., the antigen or epitope). Thus the rgdps formed by said expression may be selected or screened to provide an individual sbp member or a selected mixed population of said sbp members associated in their respective rgdps with nucleic acid encoding said sbp member or a polypeptide chain thereof. The rgdps may be selected by affinity with a member complementary to said sbp member.
- Any rgdps bound to said second member may be recovered by washing with an eluant. The washing conditions may be varied in order to obtain rgdps with different binding affinities for said epitope. Alternatively, to obtain, e.g., high affinity rgdps, the complementary member (e.g., an epitope) may be presented to the population of rgdps (e.g., pAbs) already bound to a binding member in which case pAbs with a higher affinity for the epitope will displace the already bound binding member. Thus the eluant may contain a molecule which competes with said rgdp for binding to the complementary sbp member. The rgdp may be applied to said complementary sbp member in the presence of a molecule which competes with said package for binding to said complementary sbp member. Nucleic acid derived from a selected or screened rgdp may be used to express said sbp member or a fragment or derivative thereof in a recombinant host organism. Nucleic acid from one or more rgdps may be taken and used to provide encoding nucleic acid in a further said method to obtain an individual sbp member or a mixed population of sbp members, or encoding nucleic acid therefor. The expression end product may be modified to produce a derivative thereof.
- The expression end product or derivative thereof may be used to prepare a therapeutic or prophylactic medicament or a diagnestic product.
- The present invention also provides recombinant host cells harbouring a library of nucleic acid fragments comprising fragments encoding a genetically diverse population of a type of member of a specific binding pair (sbp), each sbp member or a polypeptide component thereof being expressed as a fusion with a component of a secretable replicable genetic display package (rgdp), so that said sbp members are displayed on the surface of the rgdps in functional form and the genetic material of the rgdps encode the associated sbp member or a polypeptide component thereof. The type of sbp members may be immunoglobulins or immunoglobulin homologs, a first polypeptide chain of which is expressed as a said fusion with a component of the rgdp and a second polypeptide chain of which is expressed in free form and associates with the fused first polypeptide chain in the rgdp.
- The present invention also provides a helper phage whose genome lacks nucleic acid encoding one of its capsid proteins, or whose encoding nucleic acid therefor is conditionally defective, or which encodes said capsid protein in defective or conditionally defective form.
- The present invention also provides a bacterial host cell containing a filamentous phage genome defective for a capsid protein thereof and wherein the host cell is capable of expressing capsid protein complementing said defect such that infectious phage particles can be obtained therefrom. The complementing capsid protein may be expressed in said host from another vector contained therein. The defective capsid protein may be gene III of phage fd or its counterpart in another filamentous phage.
- The present invention also provides recombinant E. coli TG1 M13KO7 gIII No. 3 (NCTC 12478).
- The present invention also provides a phage antibody having the form of a replicable genetic display package displaying on its surface in functional form a member of a specific binding pair or a specific binding domain thereof.
- In the above methods, the binding molecule may be an antibody, or a domain that is homologous to an immunoglobulin. The antibody and/or domain may be either naturally derived or synthetic or a combination of both. The domain may be a Fab, scFv, Fv dAb or Fd molecule. Alternatively, the binding molecule may be an enzyme or receptor or fragment, derivative or analogue of any such enzyme or receptor. Alternatively, the binding molecule may be a member of an immunoglobulin superfamily and which has a structural form based on an immunoglobulin molecule.
- The present invention also provides rgdps as defined above and members of specific binding pairs e.g., binding molecules such as antibodies, enzymes, receptors, fragments and derivatives thereof, obtainable by use of any of the above defined methods. The derivatives may comprise members of the specific binding pairs fused to another molecule such as an enzyme or a Fc tail.
- The invention also includes kits for carrying out the methods hereof. The kits will include the necessary vectors. One such vector will typically have an origin of replication for single stranded bacteriophage and either contain the sbp member nucleic acid or have a restriction site for its insertion in the 5′ end region of the mature coding sequence of a phage capsid protein, and with a secretory leader coding sequence upstream of said site which directs a fusion of the capsid protein exogenous polypeptide to the periplasmic space.
- The restriction sites in the vectors are preferably those of enzymes which cut only rarely in protein coding sequences.
- The kit preferably includes a phagemid vector which may have the above characteristics, or may contain, or have a site for insertion, of sbp member nucleic acid for expression of the encoded polypeptide in free form.
- The kits will also contain ancillary components required for carrying out the method, the nature of such components depending of course on the particular method employed.
- Useful ancillary components may comprise helper phage, PCR primers, and buffers and enzymes of various kinds.
- PCR primers and associated reagents for use where the sbp members are antibodies may have the following characteristics:
- (i) primers having homology to the 51 end of the sense or anti-sense strand of sequences encoding domains of antibodies; and
- (ii) primers including
tag sequences 5′ to these homologous sequences which incorporate restriction sites to allow insertion into vectors; together with sequences to allow assembly of amplified VH and VL regions to enable expression as Fv, scFv or Fab fragments. - Buffers and enzymes are typically used to enable preparation of nucleotide sequences encoding Fv, scFv or Fab fragments derived from rearranged or unrearranged immunoglobulin genes according to the strategies described herein.
- The applicants have chosen the filamentous F-specific bacteriophages as an example of the type of phage which could provide a vehicle for the display of binding molecules, e.g., antibodies and antibody fragments and derivatives thereof, on their surface and facilitate subsequent selection and manipulation.
- The F-specific phages (e.g. fl, fd and M13) have evolved a method of propagation which does not kill the host cell and they are used commonly as vehicles for recombinant DNA (Kornberg, A., DNA Replication, W.H. Freeman and Co., San Francisco, 1980). The single stranded DNA genome (approximately 6.4 Kb) of fd is extruded through the bacterial membrane where it sequesters capsid sub-units, to produce mature virions. These virions are 6 nm in diameter, 1 μm in length and each contain approximately 2,800 molecules of the major coat protein encoded by viral gene VIII and four molecules of the adsorption molecule gene III protein (g3p) the latter is located at one end of the virion. The structure has been reviewed by Webster et al., 1978 in The Single Stranded DNA Phages, 557-569, Cold Spring Harbor Laboratory Press. The gene III product is involved in the binding of the phage to the bacterial F-pilus.
- Although these phages do not kill their host during normal replication, disruption of some of their genes can lead to cell death (Kornberg, A., 1980 supra.) This places some restraint on their use. The applicants have recognized that gene III of phage fd is an attractive possibility for the insertion of biologically active foreign sequences. There are, however, other candidate sites including for example gene VIII and gene VI.
- The protein itself is only a minor component of the phage coat and disruption of the gene does not lead to cell death (Smith, G. 1988, Virology 167: 156-165). Furthermore, it is possible to insert some foreign sequences (with no biological function) into various positions within this gene (Smith, G. 1985 Science 228: 1315-1317, Parmley, S. F. and Smith, G. P. Gene: 73 (1988) p. 305-318, and de la Cruz, V. F., et al., 1988, J. Biol. Chem., 263: 4318-4322). Smith et al described the display of peptides on the outer surface of phage but they did not describe the display of protein domains. Peptides can adopt a range of structures which can be different when in free solution, than when bound to, for example, an antibody, or when forming part of a protein (Stanfield, R. I. et al., (1990)
Science 248, p 712-719). Proteins in general have a well defined tertiary structure and perform their biological function only when adopting this structure. For example, the structure of the antibody D1.3 has been solved in the free form and when bound to antigen (Bhat, T. N. et al., (1990) Nature 347, p 483-485). The gross structure of the protein is identical in each instance with only minor variations around the binding site for the antigen. Other proteins have more substantial conformation changes on binding of ligand, for instance the enzymes hexokinase and pyruvate dehydrogenase during their catalytic cycle, but they still retain their overall pattern of folding. This structural integrity is not confined to whole proteins, but is exhibited by protein domains. This leads to the concept of a folded unit which is part of a protein, often a domain, which has a well defined primary, secondary and tertiary structure and which retains the same overall folding pattern whether binding to a binding partner or not. The only gene sequence that Smith et al., described that was of sufficient size to encode a domain (a minimum of perhaps 50 amino acids) was a 335 bp fragment of a β-galctrosidase corresponding to nucleotides 861-1195 in the β-galactosidase gene sequence (Parmley, S.+Smith, G. P. 1988 supra. This would encode 112 amino acids of a much larger 380 amino acid domain. Therefore, prior to the present application, no substantially complete domain or folded unit had been displayed on phage. In these cases, although the infectivity of the virion was disrupted, the inserted sequences could be detected on the phage surface by use of, e.g., antibodies. - The protein encoded by gene III has several domains (Pratt, D., et al., 1969 Virology 39:42-53, Grant, R. A., et al., 1981, J. Biol. Chem. 256: 539-546 and Armstrong, J., et al., FEBS Lett. 135: 167-172 1981.) including: (i) a signal sequence that directs the protein to the cell membrane and which is then cleaved off; (ii) a domain that anchors the mature protein into the bacterial cell membrane (and also the phage coat); and (iii) a domain that specifically binds to the phage receptor, the F-pilus of the host bacterium. Short sequences derived from protein molecules have been inserted into two places within the mature molecule (Smith, G., 1985 supra., and Parmley, S.F. and Smith G. P., 1988 supra). Namely, into an inter-domain region and also between
amino acids - Retaining the biological function of a molecule when it is expressed in a radically different context to its natural state is difficult. The demands on the structure of the molecule are heavy. In contrast, retaining the ability to be bound by specific antisera is a passive process which imposes far less rigorous demands on the structure of the molecule. For example, it is the rule rather than the exception that polyclonal antisera will recognise totally denatured, and biologically inactive, proteins on Western blots (see for example, Harlow, E. and Lane, D., Antibodies, a Laboratory Manual, Cold Spring Harbor Laboratory Press 1988). Therefore, the insertion of peptides into a region that allows their structure to be probed with antisera teaches only that the region allows the inserted sequences to be exposed and does not teach that the region is suitable for the insertion of large sequences with demanding structural constraints for the display of a molecule with a biological or binding function. In particular, it does not teach that domains or folded units of proteins can be displayed from sequences inserted in this region.
- This experience with Western blots is a graphic practical demonstration which shows that retaining the ability to be bound by specific antisera imposes far less rigorous demands on the structure of a polypeptide, than does folding for the retention of a biological function.
- Studies have been carried out, in which E. coli have been manipulated to express the protein β-adrenergic receptor as a fusion with the outer membrane protein lamB. The s-adrenergic receptor was expressed in a functional form as determined by the presence of binding activity. However, when an equivalent antibody fusion was made with lamB, the antibody fusion was toxic to the host cell.
- The applicants have investigated the possibility of inserting the gene coding sequence for biologically active antibody fragments into the gene III region of fd to express a large fusion protein. As is apparent from the previous discussion, this approach makes onerous demands on the functionality of the fusion protein. The insertion is large, encoding antibody fragments of at least 100-200 amino acids; the antibody derived domain must fold efficiently and correctly to display antigen-binding; and most of the functions of gene III must be retained. The applicants approach to the construction of the fusion molecule was designed to minimise the risk of disrupting these functions. In an embodiment of the invention, the initial vector used was fd-tet (Zacher, A. N., et al., 1980,
Gene 9, 127-140) a tetracycline resistant version of fd bacteriophage that can be propagated as a plasmid that confers tetracycline resistance to the infected E. coli host. The applicants chose to insert after the signal sequence of the fd gene III protein for several reasons. In particular, the applicants chose to insert afteramino acid 1 of the mature protein to retain the context for the signal peptidase cleavage. To retain the structure and function of gene III itself, the majority of the original amino acids are synthesized after the inserted immunoglobulin sequences. The inserted immunoglobulin sequences were designed to include residues from the switch region that links VH-VL to CH1-CL (Lesk, A., and Chothia, C., Nature 335, 188-190, 1988). - Surprisingly, by manipulating gene III of bacteriophage fd, the present applicants have been able to construct a bacteriophage that displays on its surface large biologically functional antibody, enzyme, and receptor molecules whilst remaining intact and infectious. Furthermore, the phages bearing antibodies of desired specificity, can be selected from a background of phages not showing this specificity.
- The sequences coding for a population of antibody molecules and for insertion into the vector to give expression of antibody binding functions on the phage surface can be derived from a variety of sources. For example, immunised or non-immunised rodents or humans, and from organs such as spleen and peripheral blood lymphocytes. The coding sequences are derived from these sources by techniques familiar to those skilled in the art (Orlandi, R., et al., 1989 supra; Larrick, J. W., et al., 1989 supra; Chiang, Y. L., et al., 1989
Bio Techniques 7, p. 360-366; Ward, E. S, et al., 1989 supra; Sastry, L., et al., 1989 supra.) or by novel linkage strategies described in examples 14, 33, 40 and 42. Novel strategies are described in examples 7, 25, 33, 39 and 40 for displaying dimeric molecules, e.g., Fab and Fv fragments on the surface of a phage. Each individual pAb in the resulting library of pAbs will express antibodies or antibody derived fragments that are monoclonal with respect to their antigen-binding characteristics. - The disclosure made by the present applicants is important and provides a significant breakthrough in the technology relating to the production of biological binding molecules, their fragments and derivatives by the use of recombinant methods.
- In standard recombinant techniques for the production of antibodies, an expression vector containing sequences coding for the antibody polypeptide chains is used to transform, e.g., E. coli. The antibody polypeptides are expressed and detected by use of standard screening systems. When the screen detects an antibody polypeptide of the desired specificity, one has to return to the particular transformed E. coli expressing the desired antibody polypeptide. Furthermore, the vector containing the coding sequence for the desired antibody polypeptide then has to be isolated for use from E. coli in further processing steps.
- In the present invention however, the desired antibody polypeptide when expressed, is already packaged with its gene coding sequence. This means that when the an antibody polypeptide of desired specificity is selected, there is no need to return to the original culture for isolation of that sequence. Furthermore, in previous methods in standard recombinant techniques, each clone expressing antibody needs to be screened individually. The present application provides for the selection of clones expressing antibodies with desired properties and thus only requires screening of clones from an enriched pool.
- Because a rgdp (e.g., a pAb) is a novel structure that displays a member of a specific binding pair (e.g., an antibody of monoclonal antigen-binding specificity) at the surface of a relatively simple replicable structure also containing the genetic information encoding the member, rgdps, e.g., pAbs, that bind to the complementary member of the specific binding pair (e.g., antigen) can be recovered very efficiently by either eluting off the complementary member using for example diethylamine, high salt, etc., and infecting suitable bacteria, or by denaturing the structure, and specifically amplifying the sequences encoding the member using PCR. That is, there is no necessity to refer back to the original bacterial clone that gave rise to the pAb.
- For some purposes, for example immunoprecipitation and some diagnostic tests, it is advantageous to use polyclonal antibodies or antibody fragments. The present invention allows this to be achieved by either selection of an enriched pool of pAbs with desired properties or by mixing individually isolated clones with desired properties. The antibodies or antibody fragments may then be expressed in soluble form if desired. Such a selected polyclonal pAb population can be grown from stocks of phage, bacteria containing phagemids or bacteria expressing soluble fragments derived from the selected polyclonal population. Thus a reagent equivalent to a polyclonal antiserum is created which can be replicated and routinely manufactured in culture without use of animals.
- Selection Formats and Affinity Maturation
- Individual rgdps, e.g., pAbs expressing the desired specificity, e.g., for an antigen, can be isolated from the complex library using the conventional screening techniques (e.g. as described in Harlow, E., and Lane, D., 1988, supra Gherardi, E et al. 1990. J. Immunol. meth. 126 p 61-68).
- The applicants have also devised a series of novel selection techniques that are practicable only because of the unique properties of rgdps. The general outline of some screening procedures is illustrated in
FIG. 2A andFIG. 2B using pAbs as an example type of rgdp. - The population/library of pAbs to be screened could be generated from immunised or other animals; or be created in vitro by mutagenising pre-existing phage antibodies (using techniques well-known in the art such as oligonucleotide directed mutagenesis (Sambrook, J., et al., 1989 Molecular Cloning a Laboratory Manual, Cold Spring Harbor Laboratory Press). This population can be screened in one or more of the formats described below with reference to
FIG. 2A andFIG. 2B , to derive those individual pAbs whose antigen binding properties are different from sample c. - Binding Elution
-
FIG. 2A shows antigen (ag) bound to a solid surface(s) the solid surface (s) may be provided by a petri dish, chromatography beads, magnetic beads and the like. The population/library of pAbs is then passed over the ag, and those individuals p that bind are retained after washing, and optionally detected with detection system d. A detection system based upon anti-fd antisera is illustrated in more detail below in example 4. If samples of bound population p are removed under increasingly stringent conditions, the binding affinity represented in each sample will increase. Conditions of increased stringency can be obtained, for example, by increasing the time of soaking or changing the pH of the soak solution, etc. - Competition
- Referring to
FIG. 2B antigen ag can be bound to a solid support s and bound to saturation by the original binding molecule c. If a population of mutant pAb (or a set of unrelated pAbs) is offered to the complex, only those that have higher affinity for antigen ag than c will bind. In most examples, only a minority of population c will be displaced by individuals from population p. If c is a traditional antibody molecule, all bound material can be recovered and bound p recovered by infecting suitable bacteria and/or by use of standard techniques such as PCR. - An advantageous application is where ag is used as a receptor and c the corresponding ligand. The recovered bound population p is then related structurally to the receptor binding site/and or ligand. This type of specificity is known to be very useful in the pharmaceutical industry.
- Another advantageous application is where ag is an antibody and c its antigen. The recovered bound population p is then an anti-idiotype antibody which have numerous uses in research and the diagnostic and pharmaceutical industries.
- At present it is difficult to select directly for anti-idiotype antibodies. pAbs would give the ability to do this directly by binding pAb libraries (e.g., a naive library) to B cells (which express antibodies on their surface) and isolating those phage that bound well.
- In some instances it may prove advantageous to pre-select population p. For example, in the anti-idiotype example above, p can be absorbed against a related antibody that does not bind the antigen.
- However, if c is a pAb, then either or both c and p can advantageously be marked in some way to both distinguish and select for bound p over bound c. This marking can be physical, for example, by pre-labelling p with biotin; or more advantageously, genetic. For example, c can be marked with an EcoB restriction site, whilst p can be marked with an EcoK restriction site (see Carter, P. et al., 1985, Nucl. Acids Res. 13, 4431-4443). When bound p+c are eluted from the antigen and used to infect suitable bacteria, there is restriction (and thus no growth) of population c (i.e. EcoB restricting bacteria in this example). Any phage that grew, would be greatly enriched for those individuals from p with higher binding affinities. Alternatively, the genetic marking can be achieved by marking p with new sequences, which can be used to specifically amplify p from the mixture using PCR.
- Since the bound pAbs can be amplified using for example PCR or bacterial infection, it is also possible to rescue the desired specificity even when insufficient individuals are bound to allow detection via conventional techniques.
- The preferred method for selection of a phage displaying a protein molecule with a desired specificity or affinity will often be elution from an affinity matrix with a ligand (e.g., example 21). Elution with increasing concentrations of ligand should elute phage displaying binding molecules of increasing affinity. However, when, e.g., a pAb binds to its antigen with high affinity or avidity (or another protein to its binding partner) it may not be possible to elute the pAb from an affinity matrix with molecule related to the antigen. Alternatively, there may be no suitable specific eluting molecule that can be prepared in sufficiently high concentration. In these cases it is necessary to use an elution method which is not specific to, e.g., the antigen-antibody complex. Some of the non-specific elution methods generally used reduce phage viability for instance, phage viability is reduced with time at pH12 (Rossomando, E. F. and Zinder N. D., J. Mol. Biol. 36 387-399 1968). There may be interactions between, e.g., antibodies and affinity matrices which cannot be disrupted without completely removing phage infectivity. In these cases a method is required to elute phage which does not rely on disruption of, e.g., the antibody - antigen interaction. A method was therefore devised which allows elution of bound pAbs under mild conditions (reduction of a dithiol group with dithiothreitol) which do not disrupt phage structure (example 47).
- This elution procedure is just one example of an elution procedure under mild conditions. A particularly advantageous method would be to introduce a nucleotide sequence encoding amino acids constituting a recognition site for cleavage by a highly specific protease between the foreign gene inserted, in this instance a gene for an antibody fragment, and the sequence of the remainder of gene III. Examples of such highly specific proteases are Factor X and thrombin. After binding of the phage to an affinity matrix and elution to remove non-specific binding phage and weak binding phage, the strongly bound phage would be removed by washing the column with protease under conditions suitable for digestion at the cleavage site. This would cleave the antibody fragment from the phage particle eluting the phage. These phage would be expected to be infective, since the only protease site should be the one specifically introduced. Strongly binding phage could then be recovered by infecting e.g., E. coli TG1 cells.
- An alternative procedure to the above is to take the affinity matrix which has retained the strongly bound pAb and extract the DNA, for example by boiling in SDS solution. Extracted DNA can then be used to directly transform E. coli host cells or alternatively the antibody encoding sequences can be amplified, for example using PCR with suitable primers such as those disclosed herein, and then inserted into a vector for expression as a soluble antibody for further study or a pAb for further rounds of selection.
- Another preferred method for selection according to affinity would be by binding to an affinity matrix containing low amounts of ligand.
- If one wishes to select from a population of phages displaying a protein molecule with a high affinity for its ligand, a preferred strategy is to bind a population of phage to an affinity matrix which contains a low amount of ligand. There is competition between phage, displaying high affinity and low affinity proteins, for binding to the ligand on the matrix. Phage displaying high affinity protein is preferentially bound and low affinity protein is washed away. The high affinity protein is then recovered by elution with the ligand or by other procedures which elute the phage from the affinity matrix (example 35 demonstrates this procedure).
- In summary then, for recovery of the packaged DNA from the affinity step, the package can be simply eluted, it can be eluted in the presence of a homologous sbp member which competes with said package for binding to a complementary sbp member; it could be removed by boiling, it could be removed by proteolytic cleavage of the protein; and other methods will be apparent to those skilled in the art e.g., destroying the link between the substrate and complementary sbp member to release said packaged DNA and sbp member. At any rate, the objective is to obtain the DNA from the package so that it can be used directly or indirectly, to express the sbp member encoded thereby.
- The efficiency of this selection procedure for pAbs and the ability to create very large libraries means that the immunisation techniques developed to increase the proportion of screened cells producing antibodies of interest will not be an absolute requirement. The technique allows the rapid isolation of binding specificities, e.g., antigen-binding specificities, including those that would be difficult or even unobtainable by conventional techniques, for example, catalytic or anti-idiotypic antibodies. Removal of the animal altogether is now possible, once a complete library of the immune repertoire has been constructed. The novel structure of the pAb molecule can be used in a number of other applications, some examples of which are:
- Signal Amplification
- Acting as a novel molecular entity in itself, rgdps, e.g., pAbs combine the ability to bind a specific molecule, e.g., antigen with amplification, if the major coat protein is used to attach another moiety. This moiety can be attached via immunological, chemical, or any other means and can be used, for example, to label the complex with detection reagents or cytotoxic molecules for use in vivo or in vitro.
- Physical Detection
- The size of the rgdps, e.g., pAbs can be used as a marker particularly with respect to physical methods of detection such as electron microscopy and/or some biosensors, e.g., surface plasmon resonance.
- Diagnostic Assays
- The rgdps, e.g., pAbs also have advantageous uses in diagnostic assays, particularly where separation can be effected using their physical properties for example centrifugation, filtration, etc.
- In order that the invention is more fully understood, embodiments will now be described in more detail by way of example only and not by way of limitation with reference to the figures described below.
-
FIG. 1 shows the basic structure of the simplest antibody molecule IgG. -
FIGS. 2A and 2B show schematically selection techniques which utilise the unique properties of pAbs; 2A shows a binding/elution system; and 2B shows a competition system (p=pAb; ag=antigen to which binding by pAb is required; c=competitor population, e.g., antibody, pAb, ligand; s=substrate (e.g. plastic beads, etc.); d=detection system. -
FIG. 3 shows the vector fd-tet and a scheme for the construction of vectors, fdTPs/Bs (for insertion of VH coding sequences) and fdTPs/Xh for the insertion of scFv coding sequences. -
FIGS. 4A-4B show the nucleotide sequences for the oligonucleotides and vectors. All sequences are drawn 5′ to 3′ and are numbered according to Beck et al., 1978, Nucl. Acid Res., 5: 4495-4503. 4a shows the sequences of the oligonucleotides used for mutagenesis (oligo's 1 and 2) or sequencing (oligo 3). The sequences shown were synthesized on an Applied Biosystems, oligonucleotide synthesizer and are complementary to the single stranded form of fd-tet (they are in the anti-sense form with respect to gene III). 4B shows the sequences of the various constructs around the gene III insertion site. These sequences are drawn in the sense orientation with respect to gene III; (A) fd-tet (and fdTδBst) (B) fdTPs/Bs and (C) fdTPs/Xh. The key restriction enzyme sites are shown along with the immunoglobulin amino acids contributed by the vectors, (amino acid single letter code is used, see Harlow, E., and Lane, D., 1988 supra.). -
FIGS. 5A-5B show the nucleotide and amino acid sequences for scFv in the vector scFvD1.3 myc. This gives the sequence of the anti-lysozyme single chain Fv and surrounding sequences in scFvD1.3 myc, showing the N-terminal pel B signal peptide sequence and the C-terminal myc tag sequence (Ward, E. S., et al., 1989, supra.). Also shown is the peptide sequence linking the VH and VL regions. The amino acid sequence is represented above the nucleotide sequence by the single letter code, see Harlow, E., and Lane D., 1988 supra. -
FIG. 6 shows the binding of pAbs to lysozyme and the effect of varying the amount of supernatant. Each point is the average of duplicate samples. Lysozyme was coated at 1 mg/ml in 50 mM NaHCO3. -
FIG. 7 shows the effect of varying the coating concentration of lysozyme or bovine serum albumin on the binding of pAbs to lysozyme in graphical form. Each point is the average of duplicate samples. -
FIG. 8 shows the sequence around the cloning site in gene III of fd-CAT2. Restriction enzyme sites are shown as well as the amino acids encoded by antibody derived sequences. These are flanked at the 5′ end by the gene III signal peptide and at the 3′ end by 3 alanine residues (encoded by theNot 1 restriction site) and the remainder of the mature gene III protein. The arrow shows the cleavage site for cutting of the signal peptide. -
FIG. 9 shows the binding of pAb (1.3) to lysozymes. Binding of phage as detected by ELISA to (a) hen egg-white lysozyme (HEL) (b) turkey egg-white lysozyme (TEL), (c) human lysozyme (HUL), (d) bovine serum albumin (BSA). A further control of (e) fdTPs/Bs to HEL. -
FIGS. 10A-11D show a map of FabD1.3 in pUC19. -
FIG. 11 shows the ELISA results providing a comparison of lysozyme-binding by phage-Fab and phage-scFv. Vector=fdCAT2 (example 5); fdscFv(OX)=pAbNQ11 (Example 9); fdVHCH1 (D1.3)=grown in normal cells (i.e. no L chain, see example 7); fdFab(D1.3) i.e. fdVHCH1 (D1.3) grown in cells containing D1.3 L chain; fdscFv (D1.3)=pAbD1.3. -
FIGS. 12A-12B show oligonucleotide probing of affinity purified phage. 1012 phage in the ratio of 1 pAb (D1.3) in 4×104 fdTPS/Bs phages were affinity purified and probed with an oligonucleotide specific for pAb (D1.3) A is a filter after one round of affinity purification (900 colonies total) and B is a filter after two rounds (372 colonies total). -
FIG. 13 shows the sequence of the anti-oxazolone antibody fragment NQ11 scFv. The sequence contributed by the linker is shown in the lower case. The sequence for VH is before the linker sequence and the sequence for VL is after the linker. -
FIG. 14 shows the ELISA results for binding pAb NQ11 and pAb D1.3 and vector fdTPs/xh to specified antigens. -
FIG. 15 shows the sequence surrounding the phoA insertion in fd-phoAla166. The restriction sites used for cloning are shown, as well as the amino acids encoded by phoA around the insertion site. The first five amino acids of the mature fusion come from gene III. -
FIG. 16 a shows the structure of gene III and the native BamHI site into which a scFv coding sequence was inserted in example 13 andFIG. 16 b shows the natural peptide linker sites A and B for possible insertion of scFv coding sequences. -
FIG. 17 shows schematically the protocol for PCR assembly of mouse VH and VLK repertoires for phage display described in example 14. -
FIG. 18 shows examples of the final products obtained with the procedure of example 14. Lanes a and b show the products of the initial PCR using heavy and light chain primers respectively; lane c shows the complete assembled 700 bp product before final digestion with Not1 and ApaL1; M1, M2 markers Φ74 Hae III digest and 123 base pair ladder (BRL Limited, P.O. Box 35, Washington Road, Paisley, Scotland), respectively. -
FIG. 19 shows the binding of 125I-PDGF-BB to fd h-PDGFB-R phage in immunoprecipitation assay and comparison to fdTPs/Bs and no phage controls; binding is expressed as a percentage of the total 125I-PDGF-BB added to the incubation. -
FIG. 20 shows the displacement of 125-PDGF-BB bound to fd-h-PDGFB-R phage using unlabelled PDGF-BB measured using an immunoprecipitation assay. Binding is expressed as a percentage of the total 125I-PDGF-BB added to the incubation. -
FIG. 21 shows the displacement of 125I-PDGF-BB bound to fd-h-PDGFB-R phage using unlabelled PDGF-BB measured using an immunoprecipitation assay. Non-specific binding of 125I-PDGF-BB to vector phage fdTPs/Bs in the absence of added unlabelled PDGF was deducted from each point. -
FIG. 22 shows the results of an ELISA of lysozyme binding by pCAT-3 scFv D1.3 phagemid in comparison with pCAT-3 vector (both rescued by M13K07) and fdCAT2 scFv D1.3 as described in example 17. The ELISA was performed as described in example 6 with modifications detailed in example 18. -
FIGS. 23A-23B show the digestion pattern seen when individual clones, selected at random from a library of single chain Fv antibody genes derived from an immunised mouse; are digested with BstN1. -
FIGS. 24A-24B show VH and VK gene sequences derived from the combinatorial library in example 21 and the hierarchical library in example 22. -
FIGS. 25A-26B show a matrix of ELISA signals for clones derived from random combinatorial library. Designation of the clones is as inFIG. 24 . The number of clones found with each combination is shown by the numerals. -
FIG. 26A shows the phagemid pHEN1 a derivative of pUC119 described in example 24; and the cloning sites in the phagemid pHEN. -
FIG. 27 . The antibody constructs cloned into fd-CAT2 and pHEN1 for display on the surface of phage. Constructs I, II, III and IV were cloned into both fd-CAT2 (as ApaLI-NotI fragments) and pHEN1 (as SfiI-NotI fragments) and pHEN1 (as SfiI-NotI fragments). All the constructs contained the heavy chain (VH) and light chain (VK) variable regions of the mouse anti-phOx antibody NQ10.12.5. The constant domains were human CK and CH1 (γ1 isotype). -
FIG. 28 . Three ways of displaying antibody fragments on the surface of phage by fusion to gene III protein. -
FIG. 29 . Western blot of supernatant taken from pHEN1-II(+) or pHEN1(−) cultures in E. coli HB2151, showing secretion of Fab fragment from pHEN1-II only. The anti-human Fab detects both H and L chain. Due to the attached c-myc tag, the L chain, highlighted by both anti-c-myc tag and anti-human CK antisera, is slightly larger (calculated Mr 24625) than the H chain (calculated Mr23145). -
FIG. 30 is a plot showing the effect of lysozyme dilution on ratio of ELISA signals obtained using pAbD1.3 or soluble scFv D1.3. -
FIG. 31 is a plot showing the effect of lysozyme dilution on ELISA signals obtained using fdTscFvD1.3 and soluble scFvD1.3. -
FIG. 32 is a plot showing positive results from an ELISA screen of phage displaying scFv fragments derived from thecell line 013 which express a monoclonal antibody directed against oestriol. -
FIG. 33 is a plot showing positive results from an ELISA screen of phage displaying scFv fragments derived from the cell line 014 which express a monoclonal antibody directed against oestriol. -
FIG. 34 is a Western Blot showing expression of the alkaline phosphatase-gene 3 fusion. 16 μl of 50 fold concentrate of each phage sample was detected on western blots with eitheranti-gene 3 antiserum (e-f) or with anti-alkaline phosphatase antiserum (c-f): - a) fd-phoAla166 grown in TG1 cells
- b) fd-phoAla166 grown in KS272 cells
- c) fdCCAT2 grown in TG1 cells
- d) fdCAT2 grown in TG1 cells, mixed with 13 ng of purified alkaline phosphatase
- e) fd-phoAla166 grown in TG1 cells
- f) fdCAT2 grown in TG1 cells.
-
FIGS. 35A-35B are Western Blots showing ultrafiltration of phage-enzyme 10 μl of 50 fold concentrate of phage (representing 5 mls of culture supernatant) was centrifuged through ultrafiltration membranes with nominal molecular weight retention of 300,000 daltons. Western blots of flow through and retentate fractions were detected with anti-alkaline phosphatase antiserum. The equivalent of 800 μl of original culture supernatant was run on the gel. -
FIG. 35A . Phage were grown in TG1 cells. a) fd-phoAla166 before ultrafiltration (short exposure). b) fd-phoAla166 before ultrafiltration. c) fd-phoAla166 material retained on ultrafiltration membrane. -
FIG. 35B . Phage were grown in KS272 cells. a) fd-phoAla166 before ultrafiltration. b) fd-phoAla166 material retained on ultrafiltration membrane. c) fdCAT2. d) fdCAT2 mixed with purified alkaline phosphatase before ultrafiltration. e) Retentate from sample d. f) Flow through from sample d. -
FIG. 36 Electrophoresis of samples from stages of a Fab assembly. Samples from different stages in the PCR Fab assembly process described in example 33 were subjected to electrophoresis on a 1% TAE-agarose gel. Samples from a comparable scFv assembly process (as in example 14) are shown for comparison. Samples left to right are:M = Markers VHCH1 = sequences encoding VHCH1 domains amplified by PCR VKCK = sequences encoding VKCK domains amplified by PCR −L = Fab assembly reaction performed in absence of linker +L = Fab PCR assembly reaction product VHCH1 plus VKCK plus linker M = Markers VK = sequences encoding VK domain amplified by PCR VL = sequences encoding VH domains amplified by PCR −L = scFv assembly reaction in absence of linker +L = scFv assembly reaction in presence of linker M = Markers -
FIG. 37 . Comparison of ELISA signals with scFv D1.3 cloned in fd-CAT2 (fd) or pCAT-3. pCAT-3 scFv1.3 has been rescued with M13K07 (KO7). M13KO7ΔgIII No 3 (gIII No 3) or M13KO7 gIIIΔNo 2 (g111No2). Phage antibodies are compared at 10 times (10×) 1 times (1×) or 0.1 times (0.1×) concentrations relative to concentration in the supernatant after overnight growth. The fdCAT2 and pCAT-3 non-recombinant vector signals were <0.01 at 10× concentration.M13KO7 gIIIΔNo 1 did not rescue at all, as judged by no signal above background in this ELISA. -
FIGS. 38A-38B . Western blot of PEG precipitated phage used in ELISA probed with anti-g3p. Free g3p and the g3p-scFvD1.3 fusion bands are arrowed. -
Sample 2—pCAT3 vector -
Sample 3—pCAT3 scFvD1.3 rescued with M13KO7, no IPTG -
Sample 4—pCAT3 scFvD1.3 rescued with M13KO7, 50 μM IPTG -
Sample 5—pCAT3 scFvD1.3 rescued with M13KO7, 100 μM IPTG -
Sample 6—pCAT3 scFvD1.3 rescued with M13KO7 gIIIΔ No 3 (no IPTG) -
Sample 7—pCAT3 scFvD1.3 rescued with M13KO7 gIIIΔ No 2 (no IPTG) -
FIG. 38A samples contain the equivalent of 8 μl of phagemid culture supernatant per track, and 80 μl of the fd supernatant (10-fold lower phage yield than the phagemid).FIG. 38B phagemid samples are those used inFIG. 38A at a five-fold higher sample loading (equivalent to 40 μl of culture supernatant per track) to enable visualisation of the fusion band in samples rescued with parental M13K07. -
FIG. 39 is a graph showing fdCAT2scFvD1.3 enrichment produced from a mixture of fdCAT2scFvD1.3 and fdCAT2TPB4 by one round of panning. -
FIG. 40 is a graph showing fdCAT2scFvD1.3 enrichment produced from a mixture of fdCAT2scFvD1.3 and fdCAT2TPB1 by one round of panning. -
FIG. 41 . Western blot of phage proteins of fdCAT2(1) and fd-tet-SNase(2) with anti-g3p antiserum. Marker molecular weights bands are indicated (kD). -
FIG. 42 . Nuclease assay of soluble SNase (3 ng)(A-1), fd-tet-SNase(4×109TU, (B-1), fd-CAT2 (2×1010TU) (C-1) and of a PEG-precipitated fdCAT2 and SNase mixture(2×1010TU and 0.7 ug)(D-1) in a 10-fold dilution series (1 to 3 or 4). Marker (M) is a HindIII digest of λ-DNA(New England Biolabs). -
FIG. 43 . ELISA signals obtained with fd-tet, fd-CD4-V1 and fd-CD4-V1V2. In each group of three, the samples are left to right phage concentrate(SN); phage concentrate plus soluble CD4(SN+sCD4); phage concentrate plus gp120 (SN+gp120). -
FIGS. 44A-44B show the DNA sequence of scfv B18 (anti-NP). -
FIG. 45 shows a map of the insert of sequences encoding FvD1.3 present in fd-tet FvD1.3 (example 39). rbs designates the ribosome binding site. Gene III is now shown in its full length. -
FIG. 46 . shows an ELISA assay of phages displaying FvD1.3 or scFvD1.3 by binding to plates coated with lysogyme. Signals obtained at various dilution factors are shown. FvD1.3 (ΔS-Stuffer) which does not express Fv was used as a control. -
FIG. 47 . shows a schematic representation of steps involved in the PCR assembly of nucleotide sequences encoding human Fab fragments. Details are in example 40. -
FIG. 48A shows a map of plasmid pJM1-FabD1.3 which is used for the expression of soluble human Fab fragments and as a template for the synthesis of linker DNA for Fab assembly.FIG. 48B is a schematic representation of sequences encoding a Fab construct.FIG. 48C shows the sequence of DNA template for the synthesis of linker DNA for Fab assembly. -
FIG. 49 . shows a schematic representation of steps involved in the PCR assembly of nucleotide sequences encoding human scFv fragments. Details are in example 42. -
FIGS. 50A-50B . ELISA assay of phage antibodies using plates coated with turkey egg lysozyme. Two clones B1 and A4 are shown derived by mutagenesis and selection from pAbD1.3 (example 45). Concentration (x axis) refers to the concentration of phage for each sample relative to the concentration in culture supernatant. B1 has raised binding to turkey egg lysogyme compared to D1.3. A4 has reduced binding to hen egg lysogyme compared to D1.3. -
FIG. 51 . ELISA of phage antibodies binding to HEL and TEL.Clone 1 is fdCAT2scFvD1.3.Clones 2 to 10 were obtained from the library (example 46) after selection. The background values as defined by binding of these clones to BSA were subtracted. -
FIG. 52 . shows the DNA sequence of the light chains D1.3 M1F and M21 derived by selection from a hierarchical library in example 46. -
FIG. 53 shows a Fv lambda expression vector (example 48) derived from pUC119. It contains the rearranged lambdal germ line gene. The heavy and light chain cassettes each contain a ribosome binding site upstream of the pel B leader (Restriction sites shown as: H=Hind III; Sp=SphI; B=BamHI, E=EcoRI. - The following procedures used by the present applicants are described in Sambrook, J. et al., 1989 supra.: restriction digestion, ligation, preparation of competent cells (Hanahan method), transformation, analysis of restriction enzyme digestion products on agarose gels, purification of DNA using phenol/chloroform, 5′-end labelling of oligonucleotides, filter screening of bacterial colonies, preparation of 2×TY medium and plates, preparation of tetracycline stock solutions, PAGE of proteins, preparation of phosphate buffered saline.
- All enzymes were supplied by New England Biolabs (CP Laboratories, PO Box 22, Bishop's Stortford, Herts., England) and were used according to manufacturer's instructions unless otherwise stated.
- The vector fd-tet (Zacher, A. N. et al., 1980, supra) was obtained from the American Type Culture Collection (ATCC No. 37000) and transformed into competent TG1 cells (genotype: K12δ (lac-pro), sup E, thi, hsdD5/F traD36, pro A+B+,
Lac 1q, lac δM15). - Viral particles were prepared by growing TG1 cells containing the desired construct in 10 to 100
mls 2×TY medium with 15 μg/ml tetracycline for 16-24 hours. The culture supernatant was collected by centrifugation for 10 mins at 10,000 rpm in an 8×50 ml rotor, Sorval RC-5B centrifuge. Phage particles were precipitated by adding⅕th volume 20% polyethylene glycol (PEG)/2.5M NaC1 and leaving at 4° C. for 1 hour. These were spun for 15 minutes as described above and the pellets resuspended in 10 mM Tris/HCl pH - This example covers the construction of two derivatives of the phage vector fd-tet: a) fdTPs/Bs for the insertion of VH coding sequences; and b) fdTPs/Xh for the insertion of scFv coding sequences. The derivative vectors have a new BstEII site for insertion of sequences.
- This example covers the insertion of scFv coding sequences derived from an anti-lysozyme antibody D1.3 into fdTPs/Xh to give the construct fdTscFvD1.3.
- This example covers the insertion of VH coding sequences derived from an anti-lysozyme antibody D1.3 into fdTPs/Bs to give the construct fdTVHD1.3.
- This example investigates the binding specificities of the constructs fdTscFvD1.3 and fdTVHD1.3.
- This example covers the construction of the derivative fdCAT2 of the phage vector fdTPs/Xh. The derivative has restriction sites for enzymes that cut DNA infrequently.
- This example shows the binding of pAb fdTscFvD1.3 to lysozyme by ELISA.
- This example concerns the display of an antibody Fab fragment at the phage surface. The VH-CH1 chain is expressed by fdCAT2. The VL-CL chain is expressed by pUC19 in a bacterial host cell also infected with fdCAT2.
- This example shows how a phage (e.g. fdTscFvD1.3) displaying a binding molecule can be isolated from vector phage by affinity techniques.
- This example concerns the insertion of scFv coding sequences derived from the anti-oxazolone antibody NQ11 into fdTPs/Xh to generate the construct pAbNQ11. The example shows the binding of pAbNQ11 to oxazalone by ELISA.
- This example shows how a phage (e.g., pAbD1.3) displaying one sort of binding molecule can be isolated from phage (e.g. pAbNQ11) displaying another sort of binding molecule by affinity techniques.
- This example concerns the invention of coding sequences for an enzyme into the vector fdCAT2 to give the phage enzyme, fdphoAla116.
- This example shows the functionality of an enzyme (alkaline phosphatase) when displayed at the phage surface (fdphoAla166).
- This example covers the insertion of scfv coding sequences derived from a) the anti-lysozyme antibody D1.3; and b) the anti-oxazalone antibody NQ11 into a BamHI site of fdTPs/Xh to give the constructs fdTBam1 having an NQ11 insert.
- This example concerns a system for the display on phage of all VH and VLK repertoires encoded by a mouse. The system involves the following steps. 1) Preparation of RNA from spleen. 2) Preparation of cDNA from the RNA 3) Use of primers specific for antibody sequences to PCR amplify all VH and VLK cDNA coding sequences 4) Use of PCR to create a linker molecule from linking pairs of VH and VLK sequences 5) Use of PCR to assemble continuous DNA molecules each comprising a VH sequence, a linker and a VLK sequence. The specific VH/VLK combination is randomly derived 6) Use of PCR to introduce restriction sites.
- This example concerns the insertion of coding sequences for the extracellular domain of the human receptor for PDGF into the vector fdCAT2 to give the construct fdhPDGFBR.
- This example shows that the human receptor PDGF Isoform BB is displayed on the surface of the phage in a form which has the ability to bind its ligand.
- This example concerns the construction of two phagemids based on pUC119 which separately contain gene III from fdCAT2 and the gene III scFv fusion fdCAT2seFvDI.3 to generate pCAT2 and pCAT3 scFvDI.3 respectively.
- This example describes the rescue of the coding sequence for the gene IIIscFv fusion from pCAT3scFvD1.3 by M13MO7 helper phage growth, phage were shown to be displaying scFv anti-lypozyme activity by ELISA.
- This example compared the efficiency of the phagemids pVC119, pCAT-3 and pCAT3scFvD1.3 and the phage fdCAT2 to transform E. coli.
- This example concerns a system for the display on phage of scFv (comprising VH and VL) from an immunised mouse using the basic technique outlined in example 14 (cDNA preparation and PCR assembly of the mouse VH and VLK repertoires) and ligating the PCR assembled sequences into fdCAT2 to create a phage library of 105 clones. Testing of 500 clones showed that none showed specificity against phox.
- This example shows that phage grown from the library established in example 20 can be subjected to affinity selection using phOX to select those phage displaying scFv with the desired specificity.
- This example concerns the construction of hierarchial libraries in which a given VH sequence is combined with the complete VLK repertoire and a given VLK sequence is combined with the complete VH repertoire and selection from these libraries of novel VH and VL pairings.
- This example concerns the separation by affinity techniques of phages displaying scFv fragments with differing binding affinities for a given antigen.
- This example concerns the construction of the phagemid pHEN1 derived from pUC119. pHEN1 has the features shown in
FIG. 26 . - This example describes the display of scFv and Fab fragment with a specificity against phOx on the surface of a bacteriophage. For display of scFv the phagemid pHEN1 comprises the sequences encoding scFv (VH and VL) for rescue by either the phages VSM13 or fdCAT2. For display of Fab the phage fdCAT2 comprises the sequence for either the H or L chain as a fusion with g3p and the phagemid pHEN1 comprises the sequence for the appropriate H or L chain partner.
- This example covers the use of phage antibodies encoding the antibody heavy or light chain to rescue a phagemid encoding a
gene 3 protein fusion with the complementary chain and the assay of Fab fragments displayed on phage in ELISA. The use of this technique in the preparation of a dual combinatorial library is discussed. - This example covers the generation of soluble scFv and Fab fragments from gene III fusions with sequences encoding these fragments by expression of clones in pHEN1 in an E. coli strain which does not suppress amber mutations.
- This example covers the use of fdTscFvD1.3 in ELISA showing that lower amounts of lysozyme can be detected with phage antibody fdTscFvD1.3 than with soluble scFvD1.3.
- This example covers the display on phage as functional scFv fragments of two clones directly derived from cells expressing monoclonal antibodies directed against oestriol.
- Both clones were established to be functional using ELISA.
- This example concerns the demonstration that the kinetic properties of an enzyme, alkaline phosphatase, displayed on phage are qualitatively similar to those of the same enzyme when in solution.
- This example concerns the construction of the phage enzyme fdphoArg166 and the demonstration that both the fusion protein made and the catalytic activity observed derive from the phage particle.
- This example concerns the binding of alkaline phosphatase displayed on phage to an arsenate-Sepharose affinity column and specific elution of these phage using the reaction product, phosphate.
- This example covers the construction of a DNA insert encoding a Fab fragment by separate amplification of heavy and light chain DNA sequences followed by assembly. The construct was then inserted into the phage vector fdCAT2 and the phagemid vector pHEN1 and the Fab fragment displayed on the surface was shown to be functional.
- This example describes the construction of a helper phage derived from M13KO7 by deleting sequences in gene III. Rescue of pCAT3-scFvD1.3 is described. The scFvD1.3 is expressed at a high level as a fusion using the deletion phage, equivalent to expression using fdCAT2-scFvD1.3.
- This example concerns the selection of bacteriophage according to the affinity of the scFv fragment directed against lysozyme which is expressed on their surface. The phage of different affinities were bound to Petri dishes coated with lysozyme and, following washing, bound phage eluted using triethylamine. Conditions were found where substantial enrichment could be obtained for a phage with a 5-fold higher affinity than the phage with which it was mixed.
- This example concerns the construction of a phage enzyme which expresses Staphylococcal nuclease and the demonstration that the phage enzyme retains nuclease activity.
- This example covers the cloning of genes for domains of CD4, a cell surface receptor and member of the immunoglobulin superfamily, into bacteriophage fd. The receptor is shown to be functional on the surface of phage by binding to the HIV protein gp120.
- This example covers the introduction of mutations into a gene for an antibody cloned in phage by growth of the phage in strains which randomly mutate DNA due to defects in DNA replication. Several mutations are introduced into phage which can then be selected from parent phage.
- This example shows that functional Fv fragments can be expressed on the surface of bacteriophage by non-covalent association of VH and VL domains. The VH domain is expressed as a gene III fusion and the VL domain as a soluble polypeptide. Sequences allowing expression of these domains from the anti-lysozyme antibody D1.3 in this form were introduced into phage and the resulting displayed Fv fragment shown to be functional by ELISA.
- This example gives methods for the assembly of Fab fragments from genes for antibodies. Examples are given for genes for antibodies directed against Rhesus-D in a human hybridoma and a polyclonal lymphoblastic cell line.
- This example concerns the construction of, and display of phage antibodies from, a phagemid encoding a human Fab fragment directed against the Rhesus D antigen. Phage displaying this antigen were then affinity selected from a background of phage displaying scFvD1.3 anti-lysozyme on the basis of binding to Rhesus-D positive red blood cells.
- This example describes the generation of libraries of scFv fragments derived from an unimmunized human. Examples are given of the preparation for phage display of libraries in phagemids of scFv fragments derived from IgG and IgM sequences.
- This example describes the isolation, from the library of scFv fragments derived from IgM genes of an unimmunized human, of clones for phage antibodies directed against BSA, lysozyme and oxazolone. Selection was by panning or affinity chromatography and analysis of binding specificity by ELISA. Sequencing of the clones showed them to be of human origin.
- This example covers the isolation, from the library of scFv fragments of unimmunized human IgM genes, of clones of phage antibodies of clones for phage antibodies specific for thyroglobulin and oxazolone. In this example rescue was with M13K07gIII No3 (NCTC12478), a helper phage defective in gene III. Fewer rounds of selection appeared necessary for a phagemid library rescued with this phage compared to one rescued with M13K07.
- This example covers the in vitro mutagenesis of pCATscFvD1.3 by replacement, with random amino acids, of residues known to be of importance in the preferential recognition of hen egg lysozyme over turkey egg lysozyme by scFvD1.3. Following selection for phage antibodies recognising turkey egg lysozyme by affinity chromatography, clones were analysed for specificity by ELISA. Two groups of clones were found with more equal recognition of hen and turkey lysozymes, one with increased ELISA signal with the turkey enzyme and one with reduced signal for the hen enzyme.
- This example shows that replacement of the VL domain of scFvD1.3 specific for hen eggwhite lysozyme (HEL) with a library of VL domains allows selection of scFv fragments which bind also to turkey eggwhite lysozyme (TEL). The scFv fragments were displayed on phage and selection by panning on tubes coated with TEL. Analysis by ELISA showed clones with enhanced binding to TEL compared to HEL. Those with highest binding to TEL were sequenced.
- This example covers the use of a cleavable bond in the affinity selection method to allow release of bound phage under mild conditions. pAbNQ11 was enriched approximately 600 fold from a mixture with pAbD1.3 by selection using biotinylated Ox-BSA bound to magnetic beads. The cleavage of a bond between BSA and the biotin allows elution of the phage.
- This example covers the use of cell selection to produce an enriched pool of genes encoding antibodies directed against 4-hydroxy-3-nitrophenylacetic acid and describes how this technique could be used to reduce the complexity of antibody repertoires displayed on the surface of bacteriophage.
- Design of Insertion Point Linkers and Construction of Vectors
- The vector fd-tet has two BstEII restriction sites flanking the tetracycline resistance gene (
FIG. 3 ). Since the strategy for inserting the VH fragments was to ligate them into a newly inserted BstEII site within gene III, it was advantageous to delete the original BstEII sites from fd-tet. This was achieved by digesting fd-tet with the restriction enzyme BstEII, filling-in the 5′ overhangs and re-ligating to generate the vector fdTδBst. Digestion of fd-tet with BstEII (0.5 units/μl) was carried out in 1×KGB buffer (100 mM potassium glutamate, 23 mM Tris-acetate (pH 7.5), 10 mM magnesium acetate, 50 μg/ml bovine serum albumin, 0.5 mM dithiothreitol (Sambrook, J., et al., 1989, supra.) with DNA at a concentration of 25 ng/μl. The 5′ overhang was filled in, using 2×KGB buffer, 250 μM each dNTP's (Pharmacia Ltd., Pharmacia House, Midsummer Boulevard, Milton Keynes, Bucks., UK.) and Klenow Fragment (Amersham International, Lincoln Place, Green End, Aylesbury, Bucks., UK) at 0.04 units/μl. After incubating for 1 hour at room temperature, DNA was extracted with phenol/chloroform and precipitated with ethanol. - Ligations were carried out at a DNA concentration of 50 ng/μl). Ligations were transformed into competent TG1 cells and plated onto TY plates supplemented with 15 μg/ml tetracycline. This selects for vectors where the gene for tetracycline resistance protein has reinserted into the vector during the ligation step. Colonies were picked into 25 mls of 2×TY medium supplemented with 15 μg/ml tetracycline and grown overnight at 37° C.
- Double stranded DNA was purified form the resulting clones using the gene-clean II kit (Bio101 Inc.,
PO Box 2284, La Jolla, Calif., 92038-2284, USA) and according to the small scale rapid plasmid DNA isolation procedure described therein. The orientation of 5 of the resulting clones was checked using the restriction enzyme ClaI. A clone was chosen which gave the same pattern of restriction by ClaI as fd-tet, but which had no BstE II sites. - In vitro mutagenesis of fdTδBst was used to generate vectors having appropriate restriction sites that facilitate cloning of antibody fragments downstream of the gene III signal peptide and in frame with the gene III coding sequence. The oligonucleotide directed mutagenesis system version 2 (Amersham International) was used with oligo 1 (
FIG. 4 a) to create fdTPs/Bs (to facilitate cloning of VH fragments). The sequence offdTPs/Bs (FIG. 4 a) was confirmed using the SEQUENASE version 2.0 kit (USB Corp., PO Box 22400, Cleveland, Ohio, 44122, USA.) with oligo 3 (FIG. 4 ) as a primer. - A second vector fdTPs/Xh (to facilitate cloning of single chain Fv fragments) was generated by mutagenising fdTPs/Bs with
oligo 2 according to the method of Venkitaraman, A. R., Nucl. Acid Res. 17, p 3314. The sequence of fdTPs/Xh (FIG. 4 ) was confirmed using the sequenase version 2.0 kit (USB Corp.) witholigo 3 as a primer. - Clearly, alternative constructions will be apparent to those skilled in the art. For example, M13 and/or its host bacteria could be modified such that its gene III could be disrupted without the onset of excessive cell death; the modified fd gene III, or other modified protein, could be incorporated into a plasmid containing a single stranded phage replication origin, such as pUC119, superinfection with modified phage such as KO7 would then result in the encapsulation of the phage antibody genome in a coat partially derived from the helper phage and partly from the phage antibody gene III construct.
- The detailed construction of a vector such as fdTPs/Bs is only one way of achieving the end of a phage antibody. For example, techniques such as sticky feet cloning/mutagenesis (Clackson, T. and Winter, G. 1989 Nucl. Acids. Res., 17, p 10163-10170) could be used to avoid use of restriction enzyme digests and/or ligation steps.
- Insertion of Immunoglobulin Fv Domain into Phage
- The plasmid scFv D1.3 myc (gift from g. Winter and A. Griffiths) contains VH and VL sequences from the antibody D1.3 fused via a peptide linker sequence to form a single chain Fv version of antibody D1.3. The sequence of the scFv and surrounding sequences in scFvD1.3 myc is shown in
FIG. 5 . - The D1.3 antibody is directed against hen egg lysozyme (Harper, M. et al., 1987, Molec. Immunol. 24, 97-108) and the scFv form expressed in E. coli has the same specificity (A. Griffiths and G. Winter personal Communication).
- Digestion of scFv D1.3 myc with Pstl and Xhol (these restriction sites are shown on
FIG. 5 ), excises a fragment of 693 bp which encodes the bulk of the scFv. Ligation of this fragment into fdTPs/Xh cleaved with Pst1 and Xhol gave rise to the construct fdTscFvD1.3 encoding the gene III signal peptide and first amino acid fused to the complete D1.3 scFv, followed by the mature gene III protein fromamino acid 2. - The vector fdTPs/Xh was prepared for ligation by digesting with the Pst1 and Xhol for 2 hours followed by digestion with calf intestinal alkaline phosphatase (Boehringer Mannheim UK Ltd., Bell Lane, Lewes, East Sussex, BN7 1LG) at one unit/ul for 30 minutes at 37° C. Fresh calf intestinal alkaline phosphatase was added to a final total concentration of 2 units/ul and incubated for a further 30 minutes at 37° C. The reaction was extracted three times with phenol/chloroform, precipitated with ethanol and dissolved in water. The insert from scFvD1.3 myc was excised with the appropriate restriction enzymes (PstI and XhoI) extracted twice with phenol/chloroform, precipitated with ethanol and dissolved in water. Ligations were carried out as described in example 1, except both vector and insert samples were at a final concentration of 5 ng/ul each. The formation of the correct construct was confirmed by sequencing as described in example 1.
- To demonstrate that proteins of the expected size were produced, virions were concentrated by PEG precipitation as described above. The samples were prepared for electrophoresis as described in Sambrook J. et al 1989 supra. The equivalent of 2 mls of supernatant was loaded onto an 18% SDS polyacrylamide gel. After electrophoresis, the gel was soaked in gel running buffer (50 mM tris, 380 mM Glycine, 0.1% SDS) with 20% methanol for 15 minutes. Transfer to nitrocellulose filter was executed in fresh 1×running buffer/20% methanol using TE70 Semi Phor a semi-dry blotting apparatus (Hoeffer, 654 Minnesota Street, Box 77387, San Francisco, Calif. 94107, USA).
- After transfer, the filter was blocked by incubation for 1 hour in a 2% solution of milk powder (Marvel) in phosphate buffered saline (PBS). Detection of scFv and VH protein sequences in the phage antibody fusion proteins was effected by soaking the filter for 1 hour with a 1/1000 dilution (in 2% milk powder) of a rabbit polyclonal antiserum raised against affinity purified, bacterially expressed scFv fragment (gift from G. Winter). After washing with PBS (3×5 minute washes), bound primary antibody was detected using an anti-rabbit antibody conjugated to horseradish peroxidase (sigma, Fancy Road, Poole, Dorset, BH17 7NH, UK.) for 1 hour. The filter was washed in PBS/0.1% triton X-100 and developed with 0.5 mg/
ml - The results showed that with clones fdTVHD1.3 (from example 3 incorporating sequences coding for VH) and fdTscFvD1.3 (incorporating sequences coding for scFv) a protein of between 69,000 and 92,500 daltons is detected by the anti-Fv serum. This is the expected size for the fusion proteins constructed. This product is not observed in supernatants derived from fd-tet, fdTδBst or fdTPs/Xh.
- Insertion of Immunoglobulin VH Domain into Phage Antibody
- The VH fragment from D1.3 was generated from the plasmid pSW1-VHD1.3-TAG1 (Ward, E. S. et al., 1989 supra.).
- Digestion of this plasmid with Pst1 and BstEII generates the fragment shown between positions 113 and 432 in
FIG. 5 . Cloning of this fragment into the Pst1 and BstEII sites of fdTPs/Bs gave rise to the construct fdTVHD1.3 which encodes a fusion protein with a complete VH domain inserted between the first and third amino acids of the mature gene III protein (amino acid two has been deleted). - The methods used were exactly as in example 2 except that the vector used was fdTPs/Bs digested with Pst1 and BstEII.
- Analysis of Binding Specificity of Phage Antibodies
- The binding of the various phage antibodies to the specific antigen, lysozyme, was analysed using ELISA techniques. Phage antibodies (e.g. fdTVHD1.3 and fdTsc/FvD1.3) were grown in E. coli and Phage antibody particles were precipitated with PEG as described in the materials and methods. Bound phage antibody particles were detected using polyclonal sheep serum raised against the closely related phage M13.
- ELISA plates were prepared by coating 96 well plates (Falcon Microtest III flexible plate. Falcon: Becton Dickinson Labware, 1950 Williams Drive, Oxnard, Calif., 93030, USA.) with 200 ul of a solution of lysozyme (1 mg/ml unless otherwise stated) in 50 mm NaHCO3 for 16-24 hours. Before use, this solution was removed, the plate rinsed several times in PBS and incubated with 200 ul of 2% milk powder/PBS for 1 hour. After rinsing several times with PBS, 100 ul of the test samples were added and incubated for 1 hour. Plates were washed (3 rinses in 0.05
% Tween 20/PBS followed by 3 rinses in PBS alone). Bound phage antibodies were detected by adding 200 ul/well of a 1/1000 dilution of sheep anti-M13 polyclonal antiserum (gift from G. Winter, although an equivalent antibody can be readily made by one skilled in the art using standard methodologies) in 2% milk powder/PBS and incubating for 1 hour. After washing as above, plates were incubated with biotinylated anti-sheep antibody (Amersham International) for 30 minutes. Plates were washed as above, and incubated with streptavidin-horseradish peroxidase complex (Amersham International). After a final wash as above, 0.5 mg/ml ABTS substrate in citrate buffer was added (ABTS=2′2′-azinobis (3-ethylbenzthiazoline sulphonic acid); citrate buffer=50 mM citric acid, 50 mM tri-sodium citrate at a ratio of 54:46. Hydrogen peroxide was added to a final concentration of 0.003% and the plates incubated for 1 hour. The optical density at 405 nm was read in a Titertek multiskan plate reader. -
FIG. 6 shows the effect of varying the amount of phage antibody. 100 ul of various dilutions of PEG precipitated phage were applied and the amount expressed in terms of the original culture volume from which it was derived. Signals derived from both the scFv containing phage antibody (fdTscFvD1.3) and the VH containing phage antibody (fdTVHD1.3) and the VH containing phage antibody were higher than that derived from the phage antibody vector (fdTPs/Xh). The highest signal to noise ratio occurs using the equivalent of 1.3 mls of culture. -
FIG. 7 shows the results of coating the plates with varying concentrations of lysozyme or bovine serum albumin (BSA). The equivalent of 1 ml of the original phage antibody culture supernatant was used. The signals from supernatants derived from fdTscFvD1.3 were again higher than those derived from fdTPs/Xh when lysozyme coated wells were used. There was no significant difference between these two types of supernatant when the plates were coated with BSA. Broadly speaking the level of signal on the plates is proportional to the amount of lysozyme coated. These results demonstrate that the binding detected is specific for lysozyme as the antigen. - Construction of
fd CAT 2 - It would be useful to design vectors that enable the use of restriction enzymes that cut DNA infrequently, thus avoiding unwanted digestion of the antibody gene inserts within their coding sequence. Enzymes with an eight base recognition sequence are particularly useful in this respect, for example Not1 and Sfil. Chaudhary et al (PNAS 87 p 1066-1070, 1990) have identified a number of restriction sites which occur rarely in antibody variable genes. The applicant has designed and constructed a vector that utilises two of these sites, as an example of how this type of enzyme can be used. Essentially sites for the enzymes ApaL1 and Not1 were engineered into fdTPs/Xh to create fdCAT2.
- The oligonucleotide: 5′ACT TTC AAC AGT TTC TGC GGC CGC CCG TTT GAT CTC GAG CTC CTG CAG TTG GAC CTG TGC ACT GTG
AGA ATA GAA 3′ (SEQ ID NO:4) was synthesised (supraFIG. 4 legend) and used to mutagenise fdTPs/Xh using an in vitro mutagenesis kit from Amersham International as described in example 1, to create fd-CAT2. The sequence of fd-CAT2 was checked around the site of manipulation by DNA sequencing. The final sequence around the insertion point within gene III is shown inFIG. 8 . N.B. fdCAT2 is also referred to herein by the alternative terminologies fd-tet-DOG1 and fdDOG1. - Specific Binding of Phage-Antibody (pAb) to Antigen
- The binding of pAb D1.3 (fdTscFvD1.3 of example 2) to lysozyme was further analysed by ELISA.
- Methods.
- 1. Phage Growth.
- Cultures of phage transduced bacteria were prepared in
- 10-100
mls 2×TY medium with 15 μg/ml tetracycline and grown with shaking at 37° C. for 16-24 hrs. Phage supernatant was prepared by centrifugation of the culture (10 min at 10,000 rpm, 8×50 ml rotor, Sorval RC-5B centrifuge). At this stage, the phage titre was 1-5×1010/ml transducing units. The phage were precipitated by adding ⅕volume 20% PEG 2.5 M NaCl, leaving for 1 hr at 4° C., and centrifuging (supra). The phage pellets were resuspended in 10 mM Tris-HC1, 1 mM EDTA pH 8.0 to 1/100th of the original volume, and residual bacteria and aggregated phage removed by centrifugation for 2 min in a bench microcentrifuge. - ELISA
- Plates were coated with antigen (1 mg/ml antigen) and blocked as described in example 4. 2×1010 phage transducing units were added to the antigen coated plates in phosphate buffered saline (PBS) containing 2% skimmed milk powder (MPBS). Plates were washed between each step with three rinses of 0.5% Tween-20 in PBS followed by three rinses of PBS. Bound phage was developed by incubating with sheep anti-M13 antisera and detected with horseradish peroxidase (HRP) conjugated anti-goat serum (Sigma, Poole, Dorset, UK) which also detects sheep immunoglobulins and ABTS (212′-azinobis (3-ethylbenzthiazoline sulphonic acid).
- Readings were taken at 405 nm after a suitable period. The results (
FIG. 9 ) show that the antibody bearing-phage had the same pattern of reactivity as the original D1.3 antibody (Harper, M., Lema, F., Boulot, C., and Poljak, F. J. (1987) Molec. Immunol. 24, 97-108), and bound to hen egg-white lysozyme, but not to turkey egg-white lysozyme, human lysozyme or bovine serum albumin. The specificity of the phage is particularly illustrated by the lack of binding to the turkey egg-white lysozyme that differs from hen egg-white lysozyme by only 7 amino acids. - Expression of Fab D1.3
- The aim of this example was to demonstrate that the scFv format used in example 2 was only one way of displaying antibody fragments in the pAb system. A more commonly used antibody fragment is the Fab fragment (
FIG. 1 ) and this example describes the construction of a pAb that expresses a Fab-like fragment on its surface and shows that it binds specifically to its antigen. The applicant chose to express the heavy chain of the antibody fragment consisting of the VH and CH1 domains from coding sequences within the pAb itself and to co-express the light chain in the bacterial host cell infected with the pAb. The VH and CH1 regions of anti-lysozyme antibody D1.3 were cloned in fd CAT2, and the corresponding light chain cloned in plasmid pUC19. The work of Skerra and Pluckthun (Science 240, p 1038-1040 (1988) and Better et al 1988 supra; demonstrated that multimeric antigen binding fragments of the antibody molecule could be secreted into the periplasm of the bacterial cell in a functional form using suitable signal sequences. However, in these publications, special measures were described as being needed to recover the binding protein from the cell, for example Skerra and Pluckham needed to recover the Fv fragment from the periplasm by affinity chromatography. The present applicants have shown that it is possible to direct the binding molecule to the outside of the cell on a phage particle, a process that requires several events to occur: correct secretion and folding of the binding molecule; association of the chains of the binding molecule; correct assembly of the phage particle; and export of the intact phage particle from the cell. - Alternatively, it is possible however, to express the light chain from within the pAb genome by, for example, cloning an expression cassette into a suitable place in the phage genome. Such a suitable place would be the intergenic region which houses the multicloning sites engineered into derivative of the related phage M13 (see, for example, Yanisch-Perron, C. et al., Gene 33, p 103-119, (1985)).
- The starting point for this example was the clone Fab D1.3 in pUC19, a map of which is shown in
FIG. 10 . The regions hybridising with the oligonucleotides KSJ6 and 7 below are shown underlined inFIG. 10 . The sequence encoding the VH-CH1 region (defined at the 5′ and 3′ edges by the oligonucleotides KSJ6 and 7 below) was PCR amplified from Fab D1.3 in pUC19 usingoligonucleotides KSJ AGT CAG G 3′ (SEQ ID NO:5) KSJ7: 5′ GGT GAC CTC GAG TGA AGA TTT GGG CTCAAC TTT C 3′ (SEQ ID NO:6) - PCR conditions were as described in example II, except that thirty cycles of PCR amplification were performed with denaturation at 92° C. for 45 seconds, annealing at 55° C. for 1 minute and extension at 72° C. for 1 minute. The template used was DNA from TG1 cells containing Fab D1.3 in pUC19 resuspended in water and boiled. The template DNA was prepared from the colonies by picking some colony material into 100 μl of distilled H2O and boiling for 10 mins. 1 μl of this mixture was used in a 20 μl PCR. This regime resulted in amplification of the expected fragment of approximately 600 bp. This fragment was cut with Pst I and Xho I, purified from an agarose gel and ligated into
Pst 1/Xho 1-cut fdCAT2. The PCR mixture was extracted with phenol/chloroform and ethanol precipitated (Sambrook et al. supra.) before digestion with Pst1 and Xho1 (New England Biolabs according to manufacturers recommendations. The fragment was resolved on 1% Tris-Acetate EDTA agarose gel (Sambrook et al. supra) and purified using GENECLEAN (BIO 101, GENECLEAN, La Jolla, San Diego, Calif., USA) according to manufacturers recommendations. - fd-CAT2 vector DNA was digested with
Pst 1 and Xho 1 (New England BioLabs) according to manufacturers recommendations, extracted with phenol/chloroform and ethanol precipitated (Sambrook et al. supra.). - 75 ng of
Pst 1/Xho 1-digested vector DNA was ligated to 40 ng of PCR-amplified Pst1 /Xho I-digested hEGF-R fragment in 12 μl of ligation buffer (66 mM Tris HC1 (pH7.6), 5 mM MgCl2, 5 mM dithiothreitol, (100 μg/ml bovine serum albumin, 0.5 mM ATP, 0.5 mM Spermidine) and 400 units T4 DNA ligase (New England BioLabs) for 16 hours at 16° C. - Two μl of the ligation mixture was transformed into 200 μl of competent E. coli MC1061 cells, plated on 2TY agar containing 15 μg/ml tetracycline and incubated at 30° C. for 20 hours. A portion of the ligation reaction mixture was transformed into E. coli MC1061 (Available from, for example Clontech Laboratories Inc, Palo Alto, Calif.) and colonies identified by hybridisation with the oligonucleotide D1.3CDR3A as described in example 10. The presence of the VHCH1 gene fragment was likewise confirmed by PCR, using oligonucleotides KSJ6 and 7. A representative clone was called fd CAT2VHCH1 D1.3. The heavy chain was deleted from Fab D1.3 in pUC19 by Sph I cleavage of Fab D1.3 plasmid DNA. The pUC 19 2.7 Kb fragment containing the light chain gene was purified from a TAE agarose gel, and long of this DNA self-ligated and transformed into competent E. coli TG1. Cells were plated on 2TY agar containing ampicillin (100 μg/ml) and incubated at 30° C. overnight. The resulting colonies were used to make miniprep DNA (Sambrook et al. supra), and the absence of the heavy chain gene confirmed by digestion with Sph I and Hind III. A representative clone was called LCD1.3 DHC.
- An overnight culture of fd CAT2VHCH1 D1.3 cells was microcentrifuged at 13,000×g for 10 minutes and 50 μl of the supernatant containing phage particles added to 50 μl of an overnight culture of LCD1.3 DHC cells. The cells were incubated at 37° C. for 10 minutes and plated on 2TY agar containing ampicillin (100 μg/ml) and 15 μg/ml tetracycline.
- Phage were prepared from some of the resulting colonies and assayed for their ability to bind lysozyme as described in example 6.
- The results (
FIG. 11 ) showed that when the heavy and light chain Fab derivatives from the original antibody D1.3 were present, the pAb bound to lysozyme. pAb expressing the fd VHCH1 fragment did not bind to lysozyme unless grown in cells also expressing the light chain. This shows that a functional Fab fragment was produced by an association of the free light chain with VHCH1 fragment fused to gene III and expressed on the surface of the pAb. - Isolation of Specific, Desired Phage from a Mixture of Vector Phage.
- The applicant purified pAb (D1.3) (originally called fdTscFvD1.3 in example 2) from mixtures using antigen affinity columns. pAb (D1.3) was mixed with vector fd phage (see table 1) and approximately 1012 phage passed over a column of lysozyme-Sepharose (prepared from cyanogen bromide activated sepharose 4B (Pharmacia, Milton Keynes, Bucks, UK.) according to the manufacturers instructions. TG1 cells were infected with appropriate dilutions of the elutes and the colonies derived, were analysed by probing with an oligonucleotide that detects only the pAb (D1.3) see Table 1 and
FIGS. 12A and 12B . A thousand fold enrichment of pAb(D1.3) was seen with a single column pass. - By growing the enriched phage and passing it down the column again, enrichments of up to a million fold were seen.
- Enrichment was also demonstrated using purely immunological criteria. For example, 1012 phage (at a ratio of 1 pAb (D1.3) to 4×106 fdTPs/Bs) was subjected to two rounds of affinity selection, and then 26 colonies picked and grown overnight. The phage was then assayed for lysozyme binding by ELISA (as example 6). Five colonies yielded phage with lysozyme binding activities, see table 1, and these were shown to encode the scFv (D1.3) by PCR screening (example 13, using 30 cycles of 1 minute at 92° C., 1 minute at 60° C., 1 minute at 72° C. using CDR3PCR1 and oligo 3 (
FIG. 4A ) as primers). - Thus very rare pAbs can be fished out of large populations, by using antigen to select and then screen the phage.
- In this example, affinity chromatography of pAbs and oligonucleotide probing were carried out as described below.
- Approximately 1012 phage particles in 1 ml MPBS were loaded onto a 1 ml lysozyme-Sepharose affinity column which had been prewashed in MPBS. The column was washed in turn with 10 ml PBS; then 10
ml 50 mM Tris-HCl, 500 mM Nacl pH 7.5; then 10ml 50 mM Tris-HCl 500 mM NaCl pH 8.5; then 5mls 50 mM Tris-HCl, 500 mM NaCl pH 9.5 (adjusted with triethylamine) and then eluted with 5ml 100 mM triethylamine. The eluate was neutralised with 0.5 M sodium phosphate buffer pH 6.8 and the phage plated for analysis. For a second round of affinity chromatography, the first column eluate was plated to about 30,000 colonies per petri dish. After overnight growth, colonies were then scraped into 5ml 2×TY medium, and a 20 μl aliquot diluted into 10 ml fresh medium and grown overnight. The phage was PEG precipitated as described above, resuspended in 1 ml MPBS and loaded onto the column, washed and eluted as above. - Oligonucleotides Synthesised:
CDR3PCR1 5′ TGA GGA C(A or T) C(A or (SEQ ID NO:7) T) GC CGT CTA CTA CTG TGC 3′. - 40 pmole of oligonucleotide VH1FOR (Ward, E. S., et al (1989) Nature 341, 544-546), specific to pAb (D1.3) was phosphorylated with 100 μCi α-32P ATP, hybridised (1 pmole/ml) to nitrocellulose filters at 67° C. in 6× saline sodium citrate (SSC) Sambrook et al., supra. buffer for 30 minutes and allowed to cool to room temperature for 30 mins, washed 3×1 min at 60° C. in 0.1×SSC.
- Construction of pAb Expressing Anti-Hapten Activity
- Oxazolone is a hapten that is commonly used for studying the details of the immune response. The anti-oxazalone antibody, NQ11 has been described previously (E. Gherardi, R. Pannell, C. Milstein, J. Immunol. Method 126 61-68). A plasmid containing the VH and VL gene of NQ11 was converted to a scFv form by inserting the BstEII/SacI fragment of scFvD1.3 myc (nucleotides 432-499 of
FIG. 5 ) between the VH and VL genes to generate pscFvNQ11, the sequence of which is shown inFIG. 13 . This scFv was cloned into the Pst1/Xhol site of FdTPs/Xh (as described earlier) to generate pAb NQ11 has an internal Pst1 site and so it was necessary to do a complete digest of pscFvNQ11 with Xhol followed by a partial digest with Pst1). - The specific binding of pAb NQ11 was confirmed using ELISA. ELISA plates were coated at 37° C. in 50 mM NaHCO3 at a protein concentration of 200 μg/ml. Plates were coated with either hen egg lysozyme (HEL), bovine serum albumin (BSA), or BSA conjugated to oxazolone (OX-BSA) (method of conjugation in Makela O., Kartinen M., Pelkonen J. L. T., Karjalainen K. (1978) J. Exp. Med. 148 1644). Preparation of phage, binding to ELISA plates, washing and detection was as described in example 6. Samples were assayed in duplicate and the average absorbance after 10 minutes presented in
FIG. 14 . This result demonstrates that the pAb NQ11 binds the correct antigen.FIG. 14 also shows that pAb D1.3 and pAb NQ11 bind only to the antigen against which the original antibodies were raised. - Enrichment of pAb D1.3 from Mixtures of Other pAb by
Affinity Purification 3×1010 phage in 10 mls of PBSM at the ratios of pAb D1.3 to pAb NQ11 shown in table 2 were passed over a 1 ml lysozyme Sepharose column. Washing, elution and other methods were as described in example 8 unless otherwise stated. Eluates from the columns were used to infect TG1 cells which were then plated out. Colonies were probed with a probe which distinguishes pAb D1.3 from pAb NQ11. The sequence of this oligonucleotide (D1.3CDR3A) is:—5′GTA GTC AAG CCT ATAATC TCT CTC 3′ (SEQ ID NO:8). Table 2 presents the data from this experiment. An enrichment of almost 1000 fold was achieved in one round and an enrichment of over a million fold in two rounds of purification. This parallels the result described in example 8. - Insertion of a Gene Encoding an Enzyme (Alkaline Phosphatase) into fd-CAT2
- As an example of the expression of a functional enzyme on the bacteriophage surface, the applicants have chosen bacterial alkaline phosphatase, an enzyme that normally functions as a dimer (McCracken, S. and Meighen, E., J. Biol. Chem. 255, p 2396-2404, (1980)). The oligonucleotides were designed to generate a PCR product with an Apa L1 site at the 5′ end of phoA gene and a
Not 1 site at its 3′ end, thus facilitating cloning into fd-CAT 2 to create a gene III fusion protein. The oligonucleotides synthesised were: phoA1:5′TAT TCT CAC AGT GCA CAA ACT GTT GAA CGG ACA CCA GAA ATGCCT GTT CTG 3′ (SEQ ID NO:9) and, phoA2:5′ ACA TGT ACA TGC GGC CGC TTT CAG CCC CAG AGC GGC TTT C3′ (SEQ ID NO:10). The sequence of the phoA gene is presented in Chang C. N. et al., Gene 44, p 121-125 (1986). The plasmid amplified (pEK86) contains an alkaline phosphate gene which differs from the sequence of Chang et al, by a mutation which converts arginine to alamine at position 166. - The PCR reaction was carried out in 100 μl of 10 mM Tris/HC1 pH 8.3, containing 50 mM KC1, 5 mM dNTP 2.5 mM MgCl2, 0.01% gelatin, 0.25 units/μl of Taq polymerase (Cetus/Perkin Elmer) and 0.5 μg/ml template. The template was the pEK86 plasmid (described by Chaidaroglou et al., Biochemistry 27 p 8338-8343, 1988). The PCR was carried out in a Techne (Techne, Duxford, Cambridge, UK) PHC-2 dri-block using thirty cycles of 1 min at 92° C., 2 min at 50° C., 3 min at 72° C.
- The resultant product was extracted with phenol:chloroform, precipitated with ethanol, and the pellet dissolved in 35 μl water. Digestion with 0.3 units/μl of Apa L1 was carried out in 150 μl volume according to manufacturers instructions for two hours at 37° C. After heat inactivation of the enzyme at 65° C., NaC1 was added to a final concentration of 150 mM and 0.4 units/μl Not1 enzyme added. After incubation for 2 hours at 37° C., the digest was extracted with phenol:chloroform and precipitated as above, before being dissolved in 30 μl of water. The vector fd-CAT2 was sequentially digested with Apa L1 and Not1 according to the manufacturers instructions and treated with calf intestinal alkaline phosphatase as described in example 2. The sample was extracted three times with phenol:chloroform, precipitated with ethanol and dissolved in water. The ligations were performed with a final DNA concentration of 1-2 ng/μl of both the cut fd-CAT2 and the digested PCR product. The ligations were transformed into competent TG1 cells and plated on 2×TY tet plates. Identification of clones containing the desired insert was by analytical PCR performed using the conditions and primers above, on boiled samples of the resulting colonies. The correct clone containing the phoA gene fused in frame to gene III was called fd-phoAla 166. The sequence at the junction of the cloning region is given in
FIG. 15 . - Measuring Enzyme Activity of Phage-Enzyme
- Overnight cultures of TG1 or KS272 (E. coli cells lacking phoA. Strauch K. L., and Beckwith J. PNAS 85 1576-1580, 1988) cells containing either fd-phoAla 166 or fd-CAT2 were grown at 37° C. in 2×TY with 15 μg/ml tetracycline.
- Concentrated, PEG precipitated phage were prepared as described earlier. Enzyme assays (Malamy, M. H. and Horecker B. L.,
Biochemistry 3, p 1893-1897, (1964)) were carried out at 24° C. in a final concentration of 1M Tris/HC1 pH 8.0, 1 mM 4-nitrophenyl phosphate (Sigma), 1 mM MgC12. 100 μl of a two times concentrate of this reaction mixture was mixed with 100 μl of the test sample in a 96 well plate. - Absorbance readings were taken every minute for 30 minutes at a wavelength of 405 nm in a
Titretek Mk 2 plate reader. Initial reaction rates were calculated from the rate of change of absorbance using a molar absorbance of 17000 l/mol/cm. - Standard curves (amount of enzyme vs. rate of change of absorbance) were prepared using dilutions of purified bacterial alkaline phosphatase (Sigma type III) in 10 mM Tris/HC1 pH 8.0, 1 mM EDTA. The number of enzyme molecules in the phage samples were estimated from the actual rates of change of absorbance of the phage samples and comparison to this standard curve.
- The results in Table 3 show that alkaline phosphatase activity was detected in PEG precipitated material in the sample containing fd-phoAla166 but not fd-CAT2. Furthermore, the level of activity was consistent with the expected number of 1-2 dimer molecules of enzyme per phage.
- The level of enzyme activity detected was not dependent on the host used for growth. In particular, fd-phoAla166 grown on phoA minus hosts showed alkaline phosphatase activity.
- Therefore, the phage expressed active alkaline phosphatase enzyme, from the phoA-gene III fusion, on the phage surface.
- Insertion of Binding Molecules into Alternative Sites in the Phage
- The availability of an alternative site in the phage for the insertion of binding molecules would open up the possibility of more easily expressing more than one binding molecule, e.g., an antibody fragment in a single pAb. This may be used to generate single or multiple binding specificities. The presence of two distinct binding activities on a single molecule will greatly increase the utility and specificity of this molecule. It may be useful in the binding of viruses with a high mutational rate such as human immunodeficiency virus. In addition, it may be used to bring antigens into close proximity (e.g. drug targetting or cell fusion) or it may act as a “molecular clamp” in chemical, immunological or enzymatic processes.
- The vector fd-tet and the derivatives described here, have a single BamHI site in
gene 3. This has previously been used for the expression of peptide fragments on the surface of filamentous bacteriophage (Smith G P. (1985) Science 228 p 1315-1317 and de la Cruz et al. (1988) J. Biol. Chem. 263 p 4318-4322). This provides a potential alternative site for the insertion of antibody fragments. - DNA fragments encoding scFv's from D1.3 or NQ11 were generated by PCR using the primers shown below. These primers were designed to generate a fragment with BamHI sites near both the terminii, to enable cloning into the BamH1 site of gene3 (see
FIG. 16 a). The oligonucleotides used, also ensure that the resulting PCR product lacks Pst1 and Xhol restriction sites normally used for manipulating the scFv's (seeFIG. 16 a). This will facilitate subsequent manipulation of a second antibody fragment in the usual way at the N terminus ofgene 3. The oligonucleotides used were:—G3Bam1 5′ TTT AAT GAG GAT CCA CAG (SEQ ID NO:11) GTG CAG CTG CAA GAG 3′G3Bam2 5′ AAC GAA TGG ATC CCG TTT (SEQ ID NO:12) GAT CTC AAG CTT 3′.
Preparation of Vector and PCR Insert - The PCR reaction was carried out in an 80 μl reaction as described in example 11 using 1 ng/μl of template and 0.25 U/μl of Taq polymerase and a cycle regime of 94° C. for 1 minute, 60° C. for 1 minute and 70° C. for 2 minutes over 30 cycles. The template was either pscFvNQ11 (example 9) or scFvD1.3 myc (example 2). Reaction products were extracted with phenol:chloroform, precipitated, dissolved in water and digested with BamH1 according to manufacturers instructions. The digest was re-extracted with phenol: chloroform, precipitated and dissolved in water.
- The vector fdTPs/Xh was cleaved with BamH1 and treated with calf intestinal phosphatase and purified as described in example 2. Ligations were set up at a vector concentration of approximately 6 ng/μl and a PCR insert concentration of approximately 3 ng/μl. These were ligated for 2.5 hours at room temperature before transforming into competent TG1 cells and plating on TY tet plates. The resultant colonies were probed as described in example 8. DNA was prepared from a number of colonies and the correct orientation and insert size confirmed by restriction digestion with Hind III in isolation or in combination with BamH1. (One Hind III site is contributed by one of the primers and the other by the vector).
- Two clones containing a D1.3 insert (fdTBam1) and fdTBam2) and one containing an NQ11 insert (NQ11Bam1) were grown up and phage prepared as described earlier. ELISAs were carried out as described in example 6. No specific signal was found for any of these clones suggesting that the natural BamH1 site is not a suitable site for insertion of a functional antibody (results not shown).
- It may be possible to clone into alternative sites to retain binding activity. The peptide repeats present in gene III may provide such a site (
FIG. 16 blocks A and B). This can be done by inserting a BamH1 site and using the PCR product described above. To facilitate this, the natural BamHl site was removed by mutagenesis with the oligonucleotide G3mutδBam shown below (using an in vitro mutagenesis kit (Amersham International)):-G3mutδBam 5′ CA AAC GAA TGG GTC CTCCTC ATT A 3′ (SEQ ID NO:13). The underlined residue replaces an A residue, thereby removing the BamHl site. DNA was prepared from a number of clones and several mutants lacking BamHl sites identified by restriction digestion. - The oligonucleotide G3 Bamlink was designed to introduce a BamHl site at a number of possible sites within the peptide linker sites A and B, see
FIG. 16 b. The sequence of the linker is:Bamlink 5′CC (G or A) CC ACC CTC GGA TCC (G or A)CC ACC CTC 3′ (SEQ ID NO:14). Its relationship to the peptide repeats in gene III is shown inFIG. 16 - PCR Assembly of Mouse VH and VL Kappa (VLK) Repertoires for Phage Display
- The principle is illustrated in
FIG. 17 . Details are provided in sections A to F below but the broad outline is first discussed. - 1. cDNA is prepared from spleen RNA from an appropriate mouse and the VH and VLK repertories individually amplified. Separately, primers reverse and complementary to VH1FOR-2 (domain 1) and VLK2BACK (domain 2) are used to amplify an existing scFv-containing DNA by PCR. (The term FOR refers to, e.g., a primer for amplification of sequences on the sense strand resulting in antisense coding sequences. The term BACK refers to, e.g., a primer for amplification of sequences on the antisense strand resulting in sense coding sequences). This generates a ‘linker’ molecule encoding the linker with the amino acid sequence (1 letter code) (GGGGS)3 (SEQ ID NO:15) which overlaps the two primary (VH and VLK) PCR products.
- 2. The separate amplified VH, VLK and linker sequences now have to be assembled into a continuous DNA molecule by use of an ‘assembly’ PCR. In the secondary ‘assembly’ PCR, the VH, VLK and linker bands are combined and assembled by virtue of the above referred to overlaps. This generates an assembled DNA fragment that will direct the expression of VH and one VLK domain. The specific VH/VLK combination is derived randomly from the separate VH and VLK repertoires referred to above.
- The assembly PCR is carried out in two stages. Firstly, 7 rounds of cycling with just the three bands present in the PCR, followed by a further 20 rounds in the presence of the flanking primers VH1BACK (referring to
domain 1 of VH) and VLKFOR. The nucleotide sequences for these oligonucleotide primers are provided under the section entitled ‘Primer Sequences’ below. This two stage process, avoids the potential problem of preferential amplification of the first combinations to be assembled.
- The assembly PCR is carried out in two stages. Firstly, 7 rounds of cycling with just the three bands present in the PCR, followed by a further 20 rounds in the presence of the flanking primers VH1BACK (referring to
- For cloning into the phage system, the assembled repertoires must be ‘tagged’ with the appropriate restriction sites. In the example provided below this is illustrated by providing an ApaL1 restriction site at the VH end of the continuous DNA molecule and a
Not 1 site at the VLK end of the molecule. This is carried out by a third stage PCR using tagged primers. The nucleotide sequences for these oligonucleotide primers are also provided under the section entitled ‘Primer Sequences’ below. There are however, 4 possible kappa light chain sequences (whereas a single consensus heavy chain sequence can be used). Therefore 4 oligonucleotide primer sequences are provided for VLK. - For this third stage PCR, sets of primers which create the new restriction site and have a further 10 nucleotides on the 5′ side of the restriction site have been used. However, long tags may give better cutting, in which case 15-20 nucleotide overhangs could be used.
- Scrupulously clean procedures must be used at all times to avoid contamination during PCR. Negative controls containing no DNA must always be included to monitor for contamination. Gel boxes must be depurinated. A dedicated GENECLEAN kit (
B10 101, GENECLEAN, La Jolla, San Diego, Calif., USA) can be used according to manufacturers instructions to extract DNA from an agarose gel. The beads, NaI and the NEW wash should be aliquoted. - All enzymes were obtained from CP Laboratories, P.O. Box 22, Bishop's Stortford, Herts CM20 3DH and the manufacturers recommended and supplied buffers were used unless otherwise stated.
- A. RNA Preparation
- RNA can be prepared using many procedures well known to those skilled in the art. As an example, the following protocol (Triton X-100 lysis, phenol/SDS RNase inactivation) gives excellent results with spleen and hybridoma cells (the addition of VRC (veronal ribosyl complex) as an RNase inhibitor is necessary for spleen cells). Guanidinium isothiocyanate/CsCl procedures (yielding total cellular RNA) also give good results but are more time-consuming.
- 1.
Harvest 1 to 5×107 cells by centrifugation in a bench tope centrifuge at 800×g for 10 minutes at 4° C. Resuspend gently in 50 ml of cold PBS buffer. Centrifuge the cells again at 800×g for 10 minutes at 4° C., and discard supernatant. - 2. On ice, add 1 ml ice-cold lysis buffer to the pellet and resuspend it with a 1 ml Gilson pepette by gently pipetting up and down. Leave on ice for 5 minutes.
- 3. After lysis, remove cell debris by centrifuging at 1300 rpm for 5 minutes in a microfuge at 4° C., in precooled tubes.
- 4. Transfer 0.5 ml of the supernatant to each of two eppendorfs containing 60
μl 10% (w/v) SDS and 250 μl phenol (previously equilibrated with 100 mM Tris-HC1 pH 8.0). Vortex hard for 2 minutes, then microfuge (13000 rpm) for five minutes at room temperature. Transfer the upper, aqueous, phase to a fresh tube. - 5. Re-extract the aqueous upper phase five times with 0.5 ml of phenol.
- 6. Precipitate with 1/10 volume 3M sodium acetate and 2.5 volumes ethanol at 20° C. overnight or dry ice-isopropanol for 30 minutes.
- 7. Wash the RNA pellet and resuspended in 50 μl to check concentration by OD260 and check 2 μg on a 1% agarose gel. 40 μg of RNA was obtained from spleen cells derived from mice.
- Lysis buffer is [10 mM Tris-HC1 pH 7.4, 1 mM MgC12, 150 mM NaCl, 10 mM VRC (New England Biolabs), 0.5% (w/v) Triton X-100], prepared fresh.
- Lysis buffer is [10 mM Tris-HC1 pH 7.4, 1 mM MgC12, 150 mM NaCl, 10 mM VRC (New England Biolabs), 0.5% (w/v) Triton X-100], prepared fresh.
B. cDNA Preparation
- cDNA can be prepared using many procedures well known to those skilled in the art. As an example, the following protocol can be used:
- 1. Set up the following reverse transcription mix:
μl H2O (DEPC-treated) 20 5 mM dNTP 10 10 × first strand buffer 10 0.1 M DTT 10 FOR primer(s) (10 pmol/μl) 2 (each) (see below) RNasin (Promega; 40 U/μl) 4
NB - i) DEPC is diethylpyrocarbonate, the function of which is to inactivate any enzymes that could degrade DNA or RNA
- ii) dNTP is deoxynucleotide triphosphate
- iii) DTT is dithiothreitol the function of which is as an antioxidant to create the reducing environment necessary for enzyme function.
- iv) RNasin is a ribonuclease inhibitor obtained from Promega Corporation, 2800 Woods Hollow Road, Madison, Wis., USA.
- 2. Dilute 10 μg RNA to 40 μl final volume with DEPC-treated water. Heat at 65° C. for 3 minutes and hold on ice for one minute (to remove secondary structure).
- 3. Add to the RNA the reverse transcription mix (58 μl) and 4 μl of the cloned reverse transcriptase ‘Super RT’ (Anglian Biotech Ltd., Whitehall House, Whitehall Road, Colchester, Essex) and incubate at 42° C. for one hour.
- 4. Boil the reaction mix for three minutes, cool on ice for one minute and then spin in a microfuge to pellet debris. Transfer the supernatant to a new tube.
- 10× first strand buffer is [1,4M KC1, 0.5M Tris-HC1 pH 8.1 at 42° C. 80MM MgCl2].
- The primers anneal to the 3′ end. Examples of kappa light chain primers are MJK1FONX, MJK2FONX, MJK4FONX and MJK5FONX (provided under ‘Primer Sequences’ below) and examples of heavy chain primers are MIGG1, 2 (CTG GAC AGG GAT CCA GAG TTC CA) (SEQ ID NO:16) and MIGG3 (CTG GAC AGG GCT CCA TAG TTC CA) (SEQ ID NO:17) which anneal to CH1.
- Alternatively, any primer that binds to the 3′ end of the variable regions VH, VLK, VL, or to the constant regions CH1, CK or CL can be used.
- C. Primary PCRs
- For each PCR and negative control, the following reactions are set up (e.g. one reaction for each of the four VLKs and four VH PCRs). In the following, the Vent DNA polymerase sold by (C.P. Laboratories Ltd (New England Biolabs) address given above) was used. The buffers are as provided by C.P. Laboratories.
μl H2O 32.5 10 × Vent buffer 5 20 × Vent BSA 2.5 5 mM dNTPs 1.5 FOR primer 10 pmol/μl)2.5 BACK primer 10 pmol/μl2.5
The FOR and BACK primers are given in the section below entitled ‘Primer Sequences’. For VH, the FOR primer is VH1FOR-2 and the BACK primer is VH1BACK. For VLK the FOR primers are MJK1FONX, MJK2FONX, MJK4FONX and MJK5FONX (for the four respective kappa light chains) and the BACK primer is VK2BACK. Only one kappa light chain BACK primer is necessary, because binding is to a nucleotide sequence common to the four kappa light chains. - UV this
mix 5 minutes. Add 2.5 μl cDNA preparation (from B above), 2 drops paraffin oil (Sigma Chemicals, Poole, Dorset, UK). Place on a cycling heating block, e.g., PHC-2 manufactured by Techne Ltd. Duxford UK, pre-set at 94°C. Add 1 μl Vent DNA polymerase under the paraffin. Amplify using 25 cycles of 94° C. 1 min, 72° C. 2 min. Post-treat at 60° C. for 5 min. - Purify on a 2% imp (low melting point agarose/TAE (tris-acetate EDTA)gel and extract the DNA to 20 μl H2O per original PCR using a GENECLEAN kit (see earlier; Bio101, La Jolla Calif., USA) in accordance with the manufacturers instructions.
- D. Preparation of Linker
- Set Up in Bulk (e.g. 10 Times)
μl H2O 34.3 10 × Vent buffer 5 20 × Vent BSA 2.5 5 mM dNTPs 2 LINKFOR primer 10 pmol/μl)2.5 LINKBACK primer 10 pmol/μl2.5 DNA from fcFv D1.3 (example 2) 1 Vent enzyme 0.2
The FOR and BACK primers are given in the section below entitled ‘Primer Sequences’. The FOR primer is LINKFOR and the BACK primer is LINKBACK. Cover with paraffin and place on the cycling heating block (see above) at 94° C. Amplify using 25 cycles of 94° C. 1 min, 65° C. 1 min, 72° C. 2 min. Post-treat at 60° C. for 5 min. - Purify on 2% 1 mp/TAE gel (using a loading dye without bromophenol blue as a 93 bp fragment is desired) and elute with SPIN-X column (Costar Limited, 205 Broadway, Cambridge, Ma. USA.,) and precipitation. Take up in 5 μl H2O per PCR reaction.
- E. Assembly PCRs
- A quarter of each PCR reaction product (5 μl) is used for each assembly. The total volume is 25 μl.
- For each of the four VLK primers, the following are set up:
H2O 4.95 10 × Vent buffer 2.5 20 × Vent BSA 1.25 5 mM dNTPs 0.8
UV irradiate this mix for 5 min. Add 5 μl each of Vh and VK band from the primary PCRs and 1.5 μl of linker as isolated from the preparative gels and extracted using the GENECLEAN kit as described in C and D above. Cover with paraffin. Place on the cycling heating block preset at 94°C. Add 1 μl Vent under the paraffin. Amplify using 7 cycles of 94° C. 2 min, 72° C. 4 min. Then return the temperature to 94° C. - Add 1.5 μl each of VH1BACK and the appropriate VKFOR primers MJK1FONX, MJK2FONX, MJK4FONX or MJK5FONX (10 pmol/μl) at 94° C. The primers should have been UV-treated as above. Amplify using 20 cycles of 94° C. 1.5 min, 72° C. 2.5 min. Post-treat at 60° C. for 5 min. Purify on 2% 1 mp/TAE gel and extract the DNA to 20 μl H2O per assembly PCR using a GENECLEAN kit (see earlier) in accordance with the manufacturers instructions.
- F. Adding Restriction Sites
- For Each Assembly and Control Set Up:
μl H2O 36.5 10 × Taq buffer 5 5 mM dNTPs 2 FOR primer (10 pmol/μl) 2.5 BACK primer (10 pmol/μl) 2.5 Assembly product 1
The FOR and BACK primers are given in the section below entitled ‘Primer Sequences’. The FOR primer is any of JK1NOT10, JK2NOT10, JK4NOT10 or JK5NOT10 (for the four respective kappa light chains) for putting a Not1 restriction site at the VLK end. The BACK primer is HBKAPA10 for putting an ApaL1 restriction site at the VH end. - Cover with paraffin and place on the cycling heating block preset at 94° C. Add 0.5 μl Cetus Taq DNA polymerase (Cetus/perkin-Elmer, Beaconsfield, Bucks, UK) under the paraffin. Amplification is carried out using 11 to 15 rounds of cycling (depends on efficiency) at 94° C. 1 min, 55° C. 1 min, 72° C. 2 min. Post-treat at 60° C. for 5 min.
- 10×Taq buffer is [0.1M Tris-HC1 pH 8.3 at 25° C., 0.5M KC1, 15 mM MgCl2, 1 mg/ml gelatin].
- G. Work-Up
- Purify once with CHC13/IAA (isoamylalcohol), once with phenol, once with CHC13/IAA and back-extract everything to ensure minimal losses. Precipitate and wash twice in 70% EtOH. Dissolve in 70 μl H2O.
Digest overnight at 37° C. with NotI: μl DNA (joined seq) 70 NEB NotI buffer × 10 10 NEB BSA × 10 10 Notl (10 U/μl) 10
The DNA (joined sequence) above refers to the assembled DNA sequence comprising in the 5′ to 3′ direction - ApaL1 restriction site
- VH sequence
- Linker sequence
- VLK sequence
- Not 1 restriction site.
- The VLK sequence may be any one of four possible kappa chain sequences.
- The enzymes Not 1 above, ApaL1 below and the buffers NEB Not 1, NEB BSA above and the NEB buffer 4 (below) are obtainable from CP Laboratories, New England Biolabs mentioned above.
- Re-precipitate, take up in 80 μl H2O. Add to this 10
μl NEB buffer μl Apal 1. - Add the enzyme ApaL1 in aliquots throughout the day, as it has a short half-life at 37° C.
- Purify on 2% 1 mp/TAE gel and extract the DNA using a GENECLEAN kit, in accordance with the manufacturers instructions. Redigest if desired.
- H. Final DNA Product
- The final DNA product is an approximate 700 bp fragment with Apa L1 and Not1 compatible ends consisting of randomly associated heavy and light chain sequences linked by a linker. A typical molecule of this type is the scFvD1.3 molecule incorporated into fdscFvD1.3 described in example 3. These molecules can then be ligated into suitable fd derived vectors, e.g., fdCAT2 (example 5), using standard techniques.
- Primer Sequences
- Primary PCR Oligos (Restrictions Sites Underlined):
VH1FOR-2 TGA GGA GAC GGT GAC CGT GGT (SEQ ID NO:18) CCC TTG GCC CC VH1BACK AGG TSM ARC TGC AGS AGT CWG (SEQ ID NO:19) G MJK1FONX CCG TTT GAT TTC CAG CTT GGT (SEQ ID NO:20) GCC MJK2FONX CCG TTT TAT TTC CAG CTT GGT (SEQ ID NO:21) CCC MJK4FONX CCG TTT TAT TTC CAA CTT TGT (SEQ ID NO:22) CCC MJK5FONX CCG TTT CAG CTC CAG CTT GGT (SEQ ID NO:23) CCC VK2BACK GAC ATT GAG CTC ACC CAG TCT (SEQ ID NO:24) CCA
Ambiguity codes M=A or C, R=A or G, S=G or C, W=A or T
PCR Oligos to Make Linker:
LINKFOR TGG AGA CTC GGT GAG CTC AAT GTC (SEQ ID NO:25) LINKBACK GGG ACC ACG GTC ACC GTC TCC TCA (SEQ ID NO:26) - For Adding Restriction Sites:
HBKAPA10 CAT GAC CAC AGT GCA CAG GTS (SEQ ID NO:27) MAR CTG CAG SAG TCW GG JKINOT10 GAG TCA TTC TGC GGC CGC CCG (SEQ ID NO:28) TTT GAT TTC CAG CTT GGT GCC JK2NOT10 GAG TCA TTC TGC GGC CGC CCG (SEQ ID NO:29) TTT TAT TTC CAG CTT GGT CCC JK4NOT10 GAG TCA TTC TGC GGC CGC CCG (SEQ ID NO:30) TTT TAT TTC CAA CTT TGT CCC JK5NOT10 GAG TCA TTC TGC GGC CGC CCG (SEQ ID NO:31) TTT CAG CTC CAG CTT GGT CCC. - Insertion of the Extracellular Domain of a Human Receptor for Platelet Derived Growth Factor (PDGF) Soform BB into fd CAT2
- A gene fragment encoding the extracellular domain of the human receptor for platelet derived growth factor isoform BB (h-PDGFB-R) was isolated by amplification, using the polymerase chain reaction, of plasmid RP41, (from the American Type Culture collection, Cat. No. 50735), a cDNA clone encoding amino-
acids 43 to 925 of the PDGF-B receptor (Gronwald, R. G. K. et al PNAS 85 p 3435-3439 (1988)).Amino acids 1 to 32 of h-PDGFB-R constitute the signal peptide. The oligonucleotide primers were designed to amplify the region of the h-PDGFB-R gene corresponding toamino acids 43 to 531 of the encoded protein. The primer RPDGF3 for the N-terminal region also included bases encoding amino acids 33 to 42 of the h-PDGFB-R protein (corresponding to the first ten amino acids from the N-terminus of the mature protein) to enable expression of the complete extracellular domain. The primers also incorporate a unique ApaL1 site at the N-terminal end of the fragment and a unique Xhol site at the C terminal end to facilitate cloning into the vector fdCAT2. The sequence of the primers is:RPDGF3 5′ CAC AGT GCA CTG GTC GTC (SEQ ID NO:32) ACA CCC CCG GGG CCA GAG CTT GTC CTC AAT GTC TCC AGC ACC TTC GTT CTG 3′RPDGF2 5′ GAT CTC GAG CTT AAA GGG (SEQ ID NO:33) CAA GGA GTG TGG CAC 3′ - PCR amplification was performed using high fidelity conditions (Eckert, K. A. and Kunkel, T. A. 1990 Nucl Acids Research 18 3739-3744). The PCR mixture contained: 20 mM Tris HC1 (pH 7.3 at 70° C., 50 mM KC1, 4 mM magnesium chloride, 0.01% gelatin, 1 mM each of dATP, dCTP, dGTP and dTTP, 500 ng/ml RP41 DNA, 1 μM each primer and 50 units/ml Taq polymerase (Cetus/Perkin Elmer, Beaconsfield, Bucks, U.K.). Thirty cycles of PCR were performed with denaturation at 92° C. for 1 min, annealing at 60° C. for 1 min and extension at 72° C. for 1.5 min. This reaction resulted in amplification of a fragment of ca. 1500 bp as expected.
- fdCAT2 vector DNA (see example 5) was digested with ApaL1 and Xhol (New England Biolabs) according to manufacturers recommendations, extracted with phenol/chloroform and ethanol precipitated (Sambrook et al, supra). Cloning of amplified RP41 DNA into this vector and identification of the desired clones was performed essentially as in example 7 except that digestion of the PCR product was with ApaL1 and
Xho 1. Colonies containing h-PDGFB-R DNA were identified by probing with 32P labelled RPDGF2 and the presence of an insert in hybridising colonies was confirmed by analytical PCR using RPDGF3 and RPDGF2 using the conditions described in example 7. - Binding of 125I-PDGF-BB to the Extracellular Domain of the Human Receptor for Platelet Derived Growth Factor Isoform BB Displayed on the Surface of fd Phage. Measured Using an Immunoprecipitation Assay.
- Phage particles, expressing the extracellular domain of the human platelet derived growth factor isoform BB receptor (fd h-PDGFB-R), were prepared by growing E. coli MC1061 cells transformed with fd h-PDGFB-R in 50 ml of 2×TY medium with 15 ug/ml tetracycline for 16 to 20 hours. Phage particles were concentrated using polyethylene glycol as described in example 6 and resuspended in PDGF binding buffer (25 mM HEPES, pH7.4, 0.15 mM NaC1, 1 mM magnesium chloride, 0.25% BSA) to 1/33rd of the original volume. Residual bacteria and undissolved material were removed by spinning for 2 min in a microcentrifuge. Immunoblots using an antiserum raised against gene III protein (Prof. I. Rashed, Konstanz, Germany) show the presence in such phage preparations of a geneIII-h-PDGFB-R protein of molecular mass 125000 corresponding to a fusion between h-PDGFB-R external domain (55000 daltons) and geneIII (apparent molecular mass 70000 on SDS-polyacrylamide gel).
- Duplicate samples of 35 μl concentrated phage were incubated with 125I-PDGF-BB (78.7fmol, 70nCi, 882 Ci/mmol; Amersham International plc, Amersham, Bucks) for 1 hour at 37° C. Controls were included in which fdTPs/Bs vector phage (
FIG. 4 ) or no phage replaced fd h-BDGFB-R phage. After this incubation, 10 ul of sheep anti-M13 polyclonal antiserum (a gift from M. Hobart) was added and incubation continued for 30 min at 200C. To each sample, 40 ul (20 ul packed volume) of protein G Sepharose Fast Flow (Pharmacia, Milton Keynes) equilibrated in PDGF binding buffer was added. Incubation was continued for 30 min at 20° C. with mixing by end over end inversion on a rotating mixer. The affinity matrix was spun down in a microcentrifuge for 2 min and the supernatant removed by aspiration. Non-specifically bound 125I-PDGF-BB was removed by resuspension of the pellet in 0.5 ml PDGF binding buffer, mixing by rotation for 5 min, centrifugation and aspiration of the supernatant, followed by two further washes with 0.5 ml 0.1% BSA, 0.2% Triton-X-100. The pellet finally obtained was resuspended in 100 ul PDGF binding buffer and counted in a Packard gamma counter. For displacement studies, unlabelled PDGF-BB (Amersham International) was added to the stated concentration for the incubation of 125I-PDGF-BB with phage. - 125I-PDGF-BB bound to the fd h-PDGFB-R phage and was immunoprecipitated in this assay. Specific binding to receptor phage was 3.5 to 4 times higher than the non-specific binding with vector phage fdTPs/Bs or no phage (
FIG. 19 ). This binding of 125I-PDGF-BB could be displaced by the inclusion of unlabelled PDGF-BB in the incubation with phage at 37° C. (FIG. 20 ). At 50 nM, unlabelled PDGF-BB the binding of 125I-PDGF-BB was reduced to the same level as the fdTPs/Bs and no phage control.FIG. 21 shows the same data, but with the non-specific binding to vector deducted. - These results indicate that a specific saturable site for 125I-PDGF-BB is expressed on fd phage containing cloned h-PDGFB-R DNA. Thus, the phage can display the functional extracellular domain of a cell surface receptor.
- Construction of Phagemid Containing GeneIII Fused with the Coding Sequence for a Binding Molecule
- It would be useful to improve the transfection efficiency of the phage-binding molecule system and also to have the possibility of displaying different numbers and specificities of binding molecules on the surface of the same bacteriophage. The applicants have devised a method that achieves both aims.
- The approach is derived from the phagemid system based on pUC119 [Vieira, J and Messing, J. (1987) Methods Enzymol. 153:3]. In brief, gene III from fd-CAT2 (example 5) and gene III scFv fusion from fd-CAT2 scFv D1.3 (example 2) were cloned downstream of the lac promoter in separate samples of pUC119, in order that the inserted gene III and gene III fusion could be ‘rescued’ by M13M07 helper phage [Vieira, J and Messing, J. et supra.] prepared according to Sambrootz et al. 1989 supra. The majority of rescued phage would be expected to contain a genome derived from the pUC119 plasmid that contains the binding molecule-gene III fusion and should express varying numbers of the binding molecule on the surface up to the normal maximum of 3-5 molecules of gene III of the surface of wild type phage. The system has been exemplified below using an antibody as the binding molecule.
- An fdCAT2 containing the single chain Fv form of the D1.3 antilysozyme antibody was formed by digesting fdTscFvD1.3 (example 2) with Pstl and Xhol, purifying the fragment containing the scFv fragment and ligating this into Pstl and Xhol digested fdCAT2. The appropriate clone, called fdCAT2 scFvD1.3 was selected after plating onto 2×TY tetracycline (15 μg/ml) and confirmed by restriction enzyme and sequence analysis.
- Gene III from fd-CAT2 (example 5) and the gene III scFv fusion from fd-CAT2 scFvD1.3 was PCR-amplified using the primers A and B shown below:
Primer A: TGC GAA GCT TTG GAG CCT (SEQ ID NO:34) TTT TTT TTG GAG ATT TTC AAC G Primer B: CAG TGA ATT CCT ATT AAG (SEQ ID NO:35) ACT CCT TAT TAC GCA GTA TGT TAG C. - Primer A anneals to the 5′ end of gene III including the ribosome binding site is located and incorporates a Hind III site. Primer B anneals to the 3′ end of gene III at the C-terminus and incorporates two UAA stop codons and an EcoR1 site. 100 ng of fd-CAT2 and fd-CAT2 scFv D1.3 DNA was used as templates for PCR-amplification in a total reaction volume of 50 μl as described in example 7, except that 20 cycles of amplification were performed: 94° C. 1 minute, 50° C. 1 minute, 72° C. 3 minutes. This resulted in amplification of the expected 1.2 Kb fragment from fd-CAT2 and a 1.8 Kb fragment from fd-CAT2 scFv D1.3.
- The PCR fragments were digested with EcoR1 and Hind III, gel-purified and ligated into Eco-R1- and Hind III-cut and dephosphorylated pUC119 DNA and transformed into E. coli TG1 using standard techniques (Sambrook et al., et supra). Transformed cells were plated on SOB agar (Sambrook et al. 1989 supra) containing 100 μg/ml ampicillin and 2% glucose. The resulting clones were called pCAT-3 (derived from fd-CAT2) and pCAT-3 scFv D1.3 (derived from fd-CAT2 scFv D1.3).
- Rescue of Anti-Lysozyme Antibody Specificity from pCAT-3 scFv D1.3 by M13KO7
- Single pCAT-3 and pCAT-3 scFv D1.3 colonies were picked into 1.5 ml 2TY containing 100 μg/ml ampicillin and 2% glucose, and grown 6 hrs at 30° C. 30 μl of these stationary cells were added to 6 mls 2YT containing 100 μg/ml ampicillin and 2% glucose in 50 ml polypropylene tubes (Falcon, Becton Dickinson Labware, 1950 Williams Drive, Oxnard, Calif. USA) and grown for 1.5 hrs at 30° C. at 380 rpm in a New Brunswick Orbital Shaker (New Brunswick Scientific Ltd., Edison House 163 Dixons Hill road, North Mimms, Hatfield, UK). Cells were pelleted by centrifugation at 5,000 g for 25 minutes and the tubes drained on tissue paper. The cell pellets were then suspended in 6 mls 2TY containing 1.25×109 p.f.u. ml-1 M13KO7 bacteriophage added. The mixture was left on ice for 5 minutes followed by growth at 35° C. for 45 minutes at 450 rpm. A cocktail was then added containing 4
μl 100 μg/ml ampicillin, 0.5 μl 0.1M IPTG and 50μl 10 mg/ml kanamycin, and the cultures grown overnight at 35° C., 450 rpm. - The following day the cultures were centrifuged and phage particles PEG precipitated as described in example 6.
- Phage pellets were resuspended in 100 μl TE (tris-EDTA see example 6) and phage titred on E. coli TG1. Aliquots of infected cells were plated on 2TY containing either 100 μg/ml ampicillin to select for pUC119 phage particles, or 50 μg/ml kanamycin to select for the M13 KO7 helper phage. Plates were incubated overnight at 37° C. and antibiotic-resistant colonies counted:
DNA ampR kanR pCAT-3 1.8 × 1011 colonies 1.2 × 109 colonies pCAT-3scFv D1.3 2.4 × 1011 colonies 2.0 × 109 colonies - This shows that the ampR phagemid particles are infective and present in the rescued phage population at a 100-fold excess over kanR M13KO7 helper phage.
- Phage were assayed for anti-lysozyme activity by ELISA as described in example 6, with the following modifications:
- 1) ELISA plates were blocked for 3 hrs with 21 Marvel/PBS.
- 2) 50 μl phage, 400
μl 1×PBS and 50μl 20% Marvel were mixed end over end for 20 minutes at room temperature before adding 150 μl per well. - 3) Phage were left to bind for 2 hours at room temperature.
- 4) All washes post phage binding were:
- 2 quick rinses PBS/0.5
% Tween 20 - 3×2 minute washes PBS/0.5
% Tween 20 - 2 quick rinses PBS no detergent
- 3×2 minute washes PBS no detergent
- The result of this ELISA is shown in
FIG. 22 , which shows that the antibody specificity can indeed be rescued efficiently. - It is considered a truism of bacterial genetics that when mutant and wild-type proteins are co-expressed in the same cell, the wild-type proteins are co-expressed in same cell, the wild-type protein is used preferentially. This is analogous to the above situation wherein mutant (i.e. antibody fusion) and wild-type gene III proteins (from M13K07) are competing for assembly as part of the pUC119 phagemid particle. It is therefore envisaged that the majority of the resulting pUC 119 phage particles will have fewer gene III-antibody fusion molecules on their surface than is the case for purely phage system described for instance in example 2. Such phagemid antibodies are therefore likely to bind antigen with a lower avidity than fd phage antibodies with three or more copies of the antibody fusion on their surfaces (there is no wild-type gene III, in the system described, for instance, in example 2), and provide a route to production of phage particles with different numbers of the same binding molecule (and hence different acidities for the ligand/antigen) or multiple different binding specificities on their surface, by using helper phage such as M13K07 to rescue cells expressing two or more gene III-antibody fusions.
- It is also possible to derive helper phage that do not encode a functional gene III in their genomes (by for example deleting the gene III sequence or a portion of it or by incorporating an amber mutation within the gene). These defective phages will only grow on appropriate cells (for example that provide functional gene III in trans, or contain an amber supressor gene), but when used to rescue phage antibodies, will only incorporate the gene III antibody fusion encoded by the phagemid into the released phage particle.
- Transformation Efficiency of pAT-3 and pCAT-3 scFv D1.3 Phagemids
- pUC 19, pCAT-3 and pCAT-3 scFv D1.3 plasmid DNAs, and fdCAT-2 phage DNA was prepared, and used to transform E. coli TG1, pCAT-3 and pCAT-3 scFv D1.3 transformations were plated on SOB agar containing 100 μg/ml ampicillin and 2% glucose, and incubated overnight at 30° C. fdCAT-2 transformations were plated on TY agar containing 15 μg/ml tetracycline and incubated overnight at 37° C. Transformation efficiencies are expressed as colonies per μg of input DNA.
DNA Transformation efficiency pUC 19 1 · 109 pCAT-3 1 · 108 pCAT-3scFv D1.3 1 · 108 fd CAT-2 8 · 105 - As expected, transformation of the phagemid vector is approximately 100-fold more efficient that the parental fdCAT-2 vector. Furthermore, the presence of a scFv antibody fragment does not compromise efficiency. This improvement in transformation efficiency is practically useful in the generation of phage antibodies libraries that have large repertoires of different binding specificities.
- PCR Assembly of a Single Chain Fv Library from an Immunised Mouse
- To demonstrate the utility of phage for the selection of antibodies from repertoires, the first requirement is to be able to prepare a diverse, representative library of the antibody repertoire of an animal and display this repertoire on the surface of bacteriophage fd.
- Cytoplasmic RNA was isolated according to example 14 from the pooled spleens of five male Balb/c mice boosted 8 weeks after primary immunisation with 2-phenyl-5-oxazolone (ph OX) coupled to chicken serum albumin. cDNA preparation and PCR assembly of the mouse VH and VL kappa repertoires for phage display was as described in example 14. The molecules thus obtained were ligated into fdCAT2.
- Vector fdCAT2 was extensively digested with Not1 and ApaL1., purified by electroelution (Sambrook et al. 1989 supra) and 1 μg ligated to 0.5 μg (5 μg for the hierarchial libraries: see example 22) of the assembled scFv genes in 1 ml with 8000 units T4 DNA ligase (New England Biolabs). The ligation was carried out overnight at 16° C. Purified ligation mix was electroporated in six aliquots into MC1061 cells (w. J. Dower, J. F. Miller & C. W. Ragsdale Nucleic Acids Res. 16 6127-6145 1988) and plated on NZY medium (Sambrook et al. 1989 supra) with 15 μg/ml tetracycline, in 243×243 mm dishes (Nunc): 90-95% of clones contained scFv genes by PCR screening. Recombinant colonies were screened by PCR (conditions as in example 7 using primers VH1BACK and MJK1FONX, MJK2FONX, MJK4FONX and MJK5FONX (see example 14) followed by digestion with the frequent cutting enzyme BstN1 (New England Biolabs, used according to the manufacturers instructions). The library of 2×105 clones appeared diverse as judged by the variety of digestion patterns seen in
FIG. 23 a andFIG. 23 b, and sequencing revealed the presence of most VH groups (R. Dildrop, Immunol.Today 5 85-86. 1984) and VK subgroups (Kabat. E. A. et al. 1987 supra) (data not shown). None of the 568 clones tested bound to phOx as detected by ELISA as in example 9. - Thus the ability to select antibody provided by the use of phage antibodies (as in example 21) is essential to readily isolate antibodies with antigen binding activity from randomly combined VH and VL domains. Very extensive screening would be required to isolate antigen-binding fragments if the random combinatorial approach of Huse et al. 1989 (supra) were used.
- Selection of Antibodies Specific for 2-phenyl-5-oxazolone from a Repertoire Derived from an Immunised Mouse
- The library prepared in example 20 was used to demonstrate that ability of the phage system to select antibodies on the basis of their antibody specificity.
- None of the 568 clones tested from the unselected library bound to phOx as detected by ELISA.
- Screening for binding of the phage to hapten was carried out by ELISA: 96-well plates were coated with 10 μg/ml phOx-BSA or 10 μg/ml BSA in phosphate-buffered saline (PBS) overnight at room temperature. Colonies of phage-transduced bacteria were inoculated into 200
μl 2×TY with 12.5 μg/ml tetracycline in 96-well plates (‘cell wells’, Nuclon) and grown with shaking (300 rpm) for 24 hours at 37° C. At this stage cultures were saturated and phage titres were reproducible (1010 TU/ml). 50 μl phage supernatant, mixed with 50 μl PBS containing 4% skimmed milk powder, was then added to the coated plates. Further details as in example 9. - The library of phages was passed down a phOx affinity column (Table 4A), and eluted with hapten. Colonies from the library prepared in example 22 were scraped into 50
ml 2×TY medium and shaken at 37° C. for 30 min. Liberated phage were precipitated twice with polyethylene glycol and resuspended to 1012 TU (transducing units)/ml in water (titred as in example 8). For affinity selection, a 1 ml column of phOx-BSA-Sepharose (O. Makela, M. Kaartinen, J. L. T. Pelonen and K. Karjalainen J. Exp. Med. 148 1644-1660, 1978) was washed with 300 ml phosphate-buffered saline (PBS), and 20 ml PBS containing 2% skimmed milk powder (MPBS). 1012 TU phage were loaded in 10 ml MPBS, washed with 10 ml MPBS and finally 200 ml PBS. The bound phage were eluted with 5ml 1 mM 4-ε-amino-caproic acid methylene 2-phenyl-oxazol-5-one (phOx-CAP; O. Makela et al. 1978, supra). About 106 TU eluted phage were amplified by infecting 1 ml log phase E. coli TG1 and plating as above. For a further round of selection, colonies were scraped into 10ml 2×TY medium and then processed as above. Of the eluted clones, 13% were found to bind to phOx after the first round selection, and ranged from poor to strong binding in ELISA. - To sequence clones, template DNA was prepared from the supernatants of 10 ml cultures grown for 24 hours, and sequenced using the dideoxy method and a Sequenase kit (USB), with primer LINKFOR (see example 14) for the VH genes and primer fdSEQ1 (5′-GAA TTT TCT GTA TGA GG-3′) (SEQ ID NO:36) for the Vk genes. Twenty-three of these hapten-binding clones were sequenced and eight different VH genes (A to H) were found in a variety of pairings with seven different Vk genes (a to g) (
FIG. 24 ). Most of the domains, such as VH-B and vk-d were ‘promiscuous’, able to bind hapten with any of several partners. - The sequences of the V-genes were related to those seen in the secondary response to phOx, but with differences (
FIG. 24 ). Thus phOx hybridomas from the secondary response employ somatically mutated derivatives of three types of Vk genes—Vkoxl. ‘Vkox-like’ and Vk45.1 genes (C. Berek, G. M. Griffiths & C. Milstein, Nature 316 412-418 (1985). These can pair with VH genes from several groups, from Vkoxl more commonly pairs with the VHoxl gene (VH group 2. R.Dildrop uupra). Vkoxl genes are always, and Vkox-like genes often, found in association with heavy chains (including VHoxl) and contain a short five residue CDR3, with the sequence motif Asp-X-Gly-X-X (SEQ ID NO:37) in which the central glycine is needed to create a cavity for phOx. In the random combinatorial library however, nearly all of the VH genes belonged togroup 1, and most of the Vk genes were α-like and associated with VH domains with a five residue CDR3, motif Asp/Asn-X-Gly-X-X (SEQ ID NO:38) (FIG. 24 ). Vkoxl and VHoxl were found only once (Vk-f and VH-E), and not in combination with each other. Indeed Vk-f lacks the Trp91 involved in phOx binding and was paired with a VH (VH-C) with a six residue CDR3. - A matrix combination of VH and VK genes was identified in phOx-binding clones selected from this random combinational library. The number of clones found with each combination are shown in
FIG. 25 . The binding to phOx-BSA, as judged by the ELISA signal, appeared to vary (marked by shading inFIG. 25 ). No binding was seen to BSA alone. - A second round of selection of the original, random combinational library from immune mice resulted in 93% of eluted clones binding phOx (Table 4). Most of these clones were Vk-d combinations, and bound strongly to phOx in ELISA (data not shown). Few weak binders were seen. This suggested that affinity chromatography had not only enriched for binders, but also for the best.
- Florescence quench titrations determined the Kd of VH-B/Vk-d for phOx-GABA as 10−8 M (example 23), indicating that antibodies with affinities representative of the secondary response can be selected from secondary response, only two (out of eleven characterised) secrete antibodies of a higher affinity than VH-B/Vk-d (C. Berek et al. 1985 supra). The Kd of VH-B/Vk-b for phOx-GABA was determined as 10−5 M (example 23). Thus phage bearing scFv fragments with weak affinities can be selected with antigen, probably due to the avidity of the multiple antibody heads on the phage.
- This example shows that antigen specificities can be isolated from libraries derived from immunised mice. It will often be desired to express these antibodies in a soluble form for further study and for use in therapeutic and diagnostic applications. Example 23 demonstrates determination of the affinity of soluble scFv fragments selected using phage antibodies. Example 27 demonstrates that soluble fragments have similar properties to those displayed on phage. For many purposes it will be desired to construct and express an antibody molecule which contains the Fc portions of the heavy chain, and perhaps vary the immunoglobulin isotype. To accomplish this, it is necessary to subclone the antigen binding sites identified using the phage selection system into a vector for expression in mammalian cells, using methodology similar to that described by Orlandi, R. et al. (1989, supra). For instance, the VH and VL genes could be amplified separately by PCR with primers containing appropriate restriction sites and inserted into vectors such as pSV-gpt HuIgG1 (L. Riechmann, et al, Nature 332, 323-327), 1988) which allows expression of the VH domain as part of a heavy chain IgG1 isotype and pSV-hyg HuCK which allows expression of the VL domain attached to the K light chain constant region. Furthermore, fusions of VH and VL domains can be made with genes encoding non-immunoglobulin proteins, for example, enzymes.
- Generation of Further Antibody Specificities by the Assembly of Hierarchical Libraries
- Further antibody specificities were derived from the library prepared and screened in examples 20 and 21 using a hierarchical approach.
- The promiscuity of the VH-B and Vk-d domains prompted the applicants to force further pairings, by assembling these genes with the entire repertoires if either Vk or VH genes from the same immunised mice. The resulting ‘hierarchical’ libraries, (VH-B×Vk-rep and VH-rep×Vk-d), each with 4×107 members, were subjected to a round of selection and hapten-binding clones isolated (Table 4). As shown by ELISA, most were strong binders. By sequencing twenty-four clones from each library, the applicants identified fourteen new partners for VH-B and thirteen for Vk-d (
FIG. 24 ). Apart from VH-B and Vk-c, none of the previous partners (or indeed other clones) from the random combinatorial library was isolated again. Again the Vk genes were mainly ox-like and the VH genes mainly group 1 (as defined in Dildrop, R. 1984 supra), but the only examples of Vkoxl (vk-h, -p, -q and -r) have Trp91, and the VH-CDR3 motif Asp-X-Gly-X-X (SEQ ID NO:37) now predominates. Thus some features of the phOx hybridomas seemed to emerge more strongly in the hierarchial library. The new partners differed from each other mainly by small alterations in the CDRs, indicating that much of the subtle diversity had remained untapped by the random combinatorial approach. More generally it has been shown that a spectrum of related antibodies can be made by keeping one of the partners fixed and varying the other, and this could prove invaluable for fine tuning of antibody affinity and specificity. - Therefore, again, phage antibodies allow a greater range of antibody molecules to be analysed for desired properties.
- This example, and example 21, demonstrate the isolation of individual antibody specificities through display on the surface of phage. However, for some purposes it may be more desirable to have a mixture of antibodies, equivalent to a polyclonal antiserum (for instance, for immunoprecipitation). To prepare a mixture of antibodies, one could mix clones and express soluble antibodies or antibody fragments or alternatively select clones from a library to give a highly enriched pool of genes encoding antibodies or antibody fragments directed against a ligand of interest and express antibodies from these clones.
- Selection of Antibodies Displayed on Bacteriophage with Different Affinities for 2-phenyl-5-oxazolone Using Affinity Chromatography
- The ELISA data shown in example 21 suggested that affinity chromatography had not only enriched for binders, but also for the best. To confirm this, the binding affinities of a strong binding and a weak binding phage were determined and then demonstrated that they could be separated from each other using affinity chromatography.
- Clones VH-B/Vk-b and VH-B/Vk-d were reamplified with MJK1FONX, MJK2FONX, MJK4FONX and MJK5FONX (see example 14) and VH1BACK-Sfil (5′-TCG CGG CCC AGC CGG CCA TGG CC(G/C) AGG T(C/G)(A/C) A(A/G)C TGC AG(C/G) AGT C(A/T)G G-3′) (SEQ ID NO:39), a primer that introduces an SfiI site (underlined) at the 5′ end of the VH gene. VH-B/Vk-d was cloned into a phagemid, e.g., pJM1 (a gift from A. Griffiths and J. Marks) as an SfiI-NotI cassette, downstream of the pelB leader for periplasmic secretion (M. Better at al. supra), with a C-terminal peptide tag for detection (see example 24 and figure), and under the control of a PL promoter (H. Shimatake & M. Rosenberg, Nature, 292, 128-132, 1981). The phagemid should have the following features: a) unique SfiI and Not1 restriction sites downstream of a pelB leader; b) a sequence encoding a C-terminal peptide tag for detection; and c) a λPL promoter controlling expression. 10 litre cultures of E. coli N4830-1 (M. E. Gottesman, S. Adhya & A. Das, J. Mol. Biol., 140, 57-75, 1980) harbouring each phagemid were induced as in K. Nagai & H. C. Thogerson (Methods Enzymol 153 461-481 1987) and supernatants precipitated with 50% ammonium sulphate. The resuspended precipitate was dialysed into PBS+0.2 mM EDTA (PBSE), loaded onto a 1.5 ml column of phOx:Sepharose and the column washed sequentially with 100 ml PBS: 100 ml 0.1 M Tris-HC1, 0.5 M NaC1, pH 8.0: 10
ml 50 mM citrate, pH 5.0: 10ml 50 mM citrate, pH4.0, and 20ml 50 mM glycine, pH 3.0. scFv fragments were eluted with 50 mM glycine, pH 2.0, neutralised with Tris base and dialysed against PBSE. VH-B/Vk-b was cloned into a phagemid vector based on pUC119 encoding identical signal and tag sequences to pJM1, and expression induced at 30° C. in a 10 litre culture of E. coli TG1 harbouring the phagemid as in D. de Bellis & I. Schwartz (1980 Nucleic Acids Res 18 1311). The low affinity of clone VH-B/Vk-b made its purification on phOx-Sepharose impossible. Therefore, after concentration by ultrafiltration (Filtron, Flowgen), the supernatant (100 ml of 600 ml) was loaded onto a 1 ml column of protein A-Sepharose coupled (E. Harlow & D. Lane, 1988, supra) to the monoclonal antibody 9E10 (Evan, G. I. et al., Mol. Cell Biol., 5, 3610-3616, 1985) that recognises the peptide tag. The column was washed with 200 ml PBS and 50 ml PBS made 0.5 M in NaC1. scFv fragments were eluted with 100 ml 0.2M glycine, pH 3.0, with neutralisation and dialysis as before. - The Kd (1.0±0.2×108 M) for clone VH-B/Vk-d was determined by fluorescence quench titration with 4-E-amino-butyric acid methylene 2-phenyl-oxazol-5-one (phOx-GABA Co. Makela et al, 1978 supra). Excitation was at 280 nm, emission was monitored at 340 nm and the Kd calculated. The Kd of the low affinity clone VH-B/Vk-b was determined as 1.8±0.3×10-5 M (not shown). To minimise light adsorption by the higher concentrations of phOx-GABA required, excitation was at 260 nm and emission was monitored at 304 nm. In addition the fluorescence values were divided by those from a parallel titration of the lysozyme binding Fv fragment D1.3. The value was calculated as in H. N. Eisen, Meth. Med. Res., 10, 115-121, 1964. A mixture of clones VH-B/Vk-b and VH-B/Vk-d, 7×1010 TU phage in the
ratio 20 VH-B/Vk-b:1 VH-B/Vk-d were loaded onto a phOx-BSA-Sepharose column in 10 ml MPBS and eluted as above. Eluted phage were used to reinfect E. coli TG1, and phage produced and harvested as before. Approximately 1011 TU phage were loaded onto a second affinity column and the process repeated to give a total of three column passes. Dilutions of eluted phage at each stage were plated in duplicate and probed separately with oligonucleotides specific for Vk-b (5′-GAG CGG GTA ACC ACT GTA CT-3′) (SEQ ID NO:40) or Vk-d (5′-GAA TGG TAT AGT ACT ACC CT-3′) (SEQ ID NO:41). After these two rounds, essentially all the eluted phage were VH-B/Vk-d (table 4). - Therefore, phage antibodies can be selected on the basis of the antigen affinity of the antibody displayed.
- Construction of Phagemid pHEN1 for the Expression of Antibody Fragments Expressed on the Surface of Bacteriophage Following Superinfection
- The phagemid pHEN1 (
FIG. 26A ) is a derivative of pUC119 (Vieira, J. & Messing, J. Methods Enzymol, 153, pp 3-11, 1987). The coding region of g3p from fdCAT2, including signal peptide and cloning sites, was amplified by PCR, using primers G3FUFO and G3FUBA (given below) (which contain EcoRI and HindIII sites respectively), and cloned as a HindIII-EcoRI fragment into pUC119. The HindIII-NotI fragment encoding the g3p signal sequence was then replaced by a pelB signal peptide (Better, M. et al., Science, 240, 1041-1043, 1988) with an internal SfiI site, allowing antibody genes to be cloned as fiI-NotI fragments. A peptide tag, c-myc, (Munro, S. & Pelham,H. Cell 46 291-300, 1986) was introduced directly after the NotI site by cloning an oligonucleotide cassette, and followed by an amber codon introduced by site-directed mutagenesis using an in vitro mutagenesis kit (Amersham International) (FIG. 26B ).G3FUFO, 5′-CAG TGA ATT CTT ATT AAG (SEQ ID NO:42) ACT CCT TAT TAC GCA GTA TGT TAG C-3′; G3FUBA, 5′-TGC GAA GCT TTG GAG CCT (SEQ ID NO:43) TTT TTT TTG GAG ATT TTC AAC G-3′; - Display of Single Chain Fv and Fab Fragments Derived from the Anti-Oxazolone Antibody NQ10.12.5 on Bacteriophage fd Using pHEN1 and fdCAT2
- A range of constructs (see
FIG. 27 ) were made from a clone (essentially construct II in pUC19) designed for expression in bacteria of a soluble Fab fragment (Better et al., 1988, see above) from the mouse anti-phOx (2-phenyl-5-oxazolone) antibody NQ10.12.5 (Griffiths, G. M., et al., Nature, 312, 271-275, 1984). In construct II, the V-regions are derived from NQ10.12.5 and attached to human Ck and CH1 (γ1 isotype) constant domains. The C-terminal cysteine residues, which normally form a covalent link between light and heavy antibody chains, have been deleted from both the constant domains. To clone heavy and light chain genes together as Fab fragments (construct II) or as separate chains (constructs III and IV) for phage display, DNA was amplified from construct II by PCR to introduce a NotI restriction site at the 3′ end, and at the 51 end either an ApaLI site (for cloning into fd-CAT2) or SfiI sie (for cloning into pHEN1). The primers FABNOTFOK with VH1BACKAPA (or VH1BACKSFI15) were used for PCR amplification of genes encoding Fab fragments (construct II), the primers FABNOTFOH with VH1BACKAPA (or VH1BACKSFI15) for heavy chains (construct III), and the primers FABNOTFOK and MVKBAAPA (or MVKBASFI) for light chains (construct IV). - The single-chain Fv version of NQ10.12.5 (construct I) has the heavy (VH) and light chain (Vk) variable domains joined by a flexible linker (Gly4Ser)3 (Huston, J. S. et al. Proc. Natl. Acad. Sci., USA, 85, 5879-5883, 1988) and was constructed from construct II by ‘splicing by overlap extension’ as in example 14. The assembled genes were reamplified with primers VK3F2NOT and VH1BACKAPA (or VH1BACKSFI15) to append restriction sites for cloning into fd-CAT2 (ApaLI-NotI) or pHEN1 (SfiI-NotI).
VH1BACKAPA, 5′-CAT GAC CAC AGT GCA (SEQ ID NO:44) CAG GT(C/G) (A/C)A (A/G) CTG CAG (C/G)AG TC(A/T) GG-3′; VH1BACKSFI15, 5′-CAT GCC ATG ACT CGC (SEQ ID NO:45) GGC CCA GCC GGC CAT GGC C(C/G)A GGT (C/G) (A/C)A (A/G)CT GCA G (C/G)A GTC (A/T)GG-3′; FABNOTFOH, 5′-CCA CGA TTC TGC GGC (SEQ ID NO:46) CGC TGA AGA TTT GGG CTC AAC TTT CTT GTC GAC-3′; FABNOTFOK, 5′-CCA CGA TTC TGC GGC (SEQ ID NO:47) CGC TGA CTC TCC GCG GTT GAA GCT CTT TGT GAC-3′; MVKBAAPA, 5′-CAC AGT GCA CTC GAC (SEQ ID NO:48) ATT GAG CTC ACC CAG TCT CCA-3′; MVKBASFI, 5′-CAT GAC CAC GCG GCC (SEQ ID NO:49) CAG CCG GCC ATG GCC GAC ATT GAG CTC ACC CAG TCT CCA-3′; VK3F2NOT, 5′-TTC TGC GGC CGC CCG (SEQ ID NO:50) TTT CAG CTC GAG CTT GGT CCC-3′.
Restriction Sites are Underlined.
Rescue of Phage and Phagemid Particles - Constructs I-IV (
FIG. 27 ) were introduced into both fd-CAT2 and pHEN1. Phage fd-CAT2 (and fd-CAT2-I, II, III or IV) was taken from the supernatant of infected E. coli TG1 after shaking at 37° C. overnight in 2×TY medium with 12.5 μg/ml tetracycline, and used directly in ELISA. Phagemid pHEN1 (and pHEN1-I and II) in E. coli TG1 (supE) were grown overnight in 2ml 2×TY medium, 100 μg/ml ampicillin, and 1% glucose (without glucose, expression of g3p prevents later superinfection by helper phage). 10 μl of the overnight culture was used to innoculate 2 ml of 2×TY medium, 100 μg/ml ampicillin, 1% glucose, and shaken at 37° C. for 1 hour. The cells were washed and resuspended in 2×TY, 100 μg/ml ampicillin, and phagemid particles rescued by adding 2 μl (108 pfu) VCSM13 helper phage (Stratagene). After growth for one hour, 4 μl kanamycin (25 mg/ml) was added, and the culture grown overnight. The phagemid particles were concentrated 10-fold for ELISA by precipitation with polyethylene glycol. - ELISA
- Detection of phage binding to 2-phenyl-5-oxazolone (phOx) was performed as in example 9. 96-well plates were coated with 10 μg/ml phOx-BSA or 10 μg/ml BSA in PBS overnight at room temperature, and blocked with PBSS containing 2% skimmed milk powder. Phage (mid) supernatant (50 μl) mixed with 50 μl PBS containing 4% skimmed milk powder was added to the wells and assayed. To detect binding of soluble scFv or Fab fragments secreted from pHEN1, the c-myc peptide tag described by Munro and Pelham 1986 supra, was detected using the anti-myc monoclonal 9E10 (Evan, G. I., et al. Mol Cell Biol, 5, 3610-3616, 1985) followed by detection with peroxidase-conjugated goat anti-mouse immonoglobulin. Other details are as in example 9.
- The constructs in fdCAT2 and pHEN1 display antibody fragments of the surface of filamentous phage. The phage vector, fd-CAT2 (
FIG. 8 ) is based on the vector fd-tet (Zacher, A. N., et al.,Gene 9 127-140, 1980) and has restriction sites (ApaLI and NotI) for cloning antibody genes (or other protein) genes for expression as fusions to the N-terminus of the phage coat protein g3p. Transcription of the antibody-g3p fusions in fd-CAT2 is driven from the gene III promoter and the fusion protein targetted to the periplasm by means of the g3p leader. Fab and scFv fragments of NQ10.12.5 cloned into fd-CAT2 for display were shown to bind to phOx-BSA (but not BSA) by ELISA (table 5). Phage were considered to be binding if A405 of the sample was at least 10-fold greater than the background in ELISA. - The phagemid vector, pHEN1 (
FIG. 26A ), is based upon pUC119 and contains restriction sites (SfiI and NotI) for cloning the fusion proteins. Here the transcription of antibody-g3p fusions is driven from the inducible lacZ promoter and the fusion protein targetted to the periplasm by means of the pelB leader. Phagemid was rescued with VCSM13 helper phage in 2×TY medium containing no glucose or IPTG: under these conditions there is sufficient expression of antibody-g3p. Fab and scFv fragments of NQ10.12.5 cloned into pHEN1 for display were shown to bind to phOx-BSA (but not BSA) by ELISA (Table 5) using the same criterion as above. - An alternative methodology for preparing libraries of Fab fragments expressed on the surface of phage would be to:
- 1. Prepare a library of phage expressing heavy chain (VHCH) genes from inserts in the phage genome.
- 2. Prepare a library of light chain genes in a plasmid expression vector in E. coli, preferably a phagemid, and isolate the soluble protein light chains expressed from this library.
- 3. Bind the soluble protein light chains from the library to the heavy chain library displayed on phage.
- 4. Select phage with the desired properties of affinity and specificity. These will encode the heavy chain (VHCH) genes.
- 5. Isolate the light chain genes encoding light chains which form suitable antigen binding sites in combination with the selected heavy chains, preferably by using superinfection of bacteria, containing phagemid expressing the light chain, with phage expressing the selected heavy chain (as described in example 20) and then assaying for antigen binding.
- Rescue of Phagemid Encoding a Gene III Protein Fusion with Antibody Heavy or Light Chains by Phage Encoding the Complementary Antibody Chain Displayed on Phage and the Use of this Technique to Make Dual Combinatorial Libraries
- With random combinatorial libraries there is a limitation on the potential diversity of displayed Fab fragments due to the transformation efficiency of bacterial cells. Described here is a strategy (dual combinatorial libraries) to overcome this problem, potentially increasing the number of phage surveyed by a factor of 107.
- For assembly of heavy and light chains expresses from different vectors, phagemid (pHEN1-III or IV) was grown in E. coli HB2151 (a non-supressor strain) to allow production of soluble chains, and rescued as above (example 27) except that helper phage were used expressing partner chains as fusions to g3p (109 TU fd-CAT2-IV or III respectively) and 2 μl tetracycline (12.5 mg/ml) in place of kanamycin. Separate Vectors to Encode Fab Heavy and Light Chains
- The heavy and light chains of Fab fragments can be encoded together in the same vector (example 25) or in different vectors. To demonstrate this the heavy chain (construct III) was cloned into pHEN1 (to provide soluble fragments) and the light chain (construct IV) into fd-CAT2 (to make the fusion with g3p). The phagemid pHEN1-III, grown in E. coli HB2151 (non-supressor) was rescued with fd-CAT2-IV phage, and phage(mid) shown to bind to phOx:BSA, but not to BSA (Table 5). This demonstrates that soluble light chain is correctly associating with the heavy chain anchored to the g3p, since neither heavy chain nor light chain alone bind antigen (Table 5).
- Similar results were obtained in the reverse experiment (with phagemid pHEN-1-IV and fd-CAT2-III phage) in which the heavy chain was produced as a soluble molecule and the light chain anchored to g3p (Table 5). Hence a Fab fragment is assembled on the surface of phage by fusion of either heavy or light chain to g3p, provided the other chain is secreted using the same or another vector (
FIG. 28 ). - The resulting phage population is a mixture of phage and rescued phagemid. The ratio of the two types of particles was assessed by infecting log phase E. coli TG1 and plating on TYE plates with either 15 μg/ml tetracycline (to select for fd-CAT2) or 100 μg/ml ampicillin (to select for pHEN1). The titre of fd-CAT2 phage was 5×1011 TU/ml and the titre of
pHEN1 2×1010 TU/ml, indicating a packaging ratio of 25 phage per phagemid. - Demonstrated here is an alternative strategy involving display of the heterodimeric antibody Fab fragments on the surface of phage. One of the chains is fused to g3p and the other is secreted in soluble form into the periplasmic space of the E. coli where it associates non-covalently with the g3p fusion, and binds specifically to antigen. Either the light or heavy chain can be fused to the g3p: they are displayed on the phage as Fab fragments and bind antigen (
FIG. 28 ). Described are both phage and phagemid vectors for surface display. Phagemids are probably superior to phage vectors for creation of large phage display libraries. Particularly in view of their higher transfection efficiencies (Two to three orders of magnitude higher), allowing larger libraries to be constructed. The phagemid vector, pHEN1 also allows the expression of soluble Fab fragments in non-suppressor E. coli. - Also demonstrated here is that heavy and light chains encoded on the same vector (construct II), or on different vectors (constructs III and IV) can be displayed as Fab fragments. This offers two distinct ways of making random combinatorial libraries for display. Libraries of heavy and light chain genes, amplified by PCR, could be randomly linked by a ‘PCR assembly’ process (example 14) based on ‘splicing by overlap extension’, cloned into phage(mid) display vectors and expressed from the same promoter as part of the same transcript (construct II) as above, or indeed from different promoters as separate transcripts. Here the phage(mid) vector encodes and displays both chains. For a combinatorial library of 107 heavy chains and 107 light chains, the potential diversity of displayed Fab fragments (1014) is limited by the transfection efficiency of bacterial cells by the vector (about 109 clones per μg cut and ligated plasmid at best) (W. J. Dower, et al, Nucl. Acids. Res., 16, 6127-6145, 1988). Libraries thus prepared are analogous to the random combinatorial library method described by Huse, W. D. et al, Science, 246, 1275-1281 (1989), but have the important additional feature that display on the surface of phage gives a powerful method of selecting antibody specificities from the large number of clones generated.
- Alternatively, libraries of heavy and light chains could be cloned into different vectors for expression in the same cell, with a phage vector encoding the g3p fusion and a phagemid encoding the soluble chain. The phage acts as a helper, and the infected bacteria produced both packaged phage and phagemid. Each phage or phagemid displays both chains but encodes only one chain and thus only the genetic information for half of the antigen-binding site. However, the genes for both antibody chains can be recovered separately by plating on the selective medium, suggesting a means by which mutually complementary pairs of antigen binding heavy and light chain combinations could be selected from random combinatorial libraries. For example, a light chain repertoire on fd phage could be used to infect cells harbouring a library of soluble heavy chains on the phagemid. The affinity purified phagemid library could then be used to infect E. coli, rescued with the affinity purified phage library, and the new combinatorial library subjected to a further round of selection. Thus, antibody heavy and light chain genes are reshuffled after each round of purification. Finally, after several rounds, infected bacteria could be plated and screened individually for antigen-binding phage. Such ‘dual’ combinatorial libraries are potentially more diverse than those encoded on a single vector. By combining separate libraries of 107 light chain phage(mid)s, the diversity of displayed Fab fragments (potentially 1014) is limited only by the number of bacteria (1012 per litre). More simply, the use of two vectors should also facilitate the construction of ‘hierarchical’ libraries, in which a fixed heavy or light chain is paired with a library or partners (example 22), offering a means of ‘fine-tuning’ antibody affinity and specificity.
- Induction of Soluble scFv and Fab Fragments Using Phagemid pHEN1
- Further study of antibodies which have been expressed on the surface of phage would be greatly facilitated if it is simple to switch to expression in solution.
- E. coli HB2151 was infected with pHEN phagemid (pHEN1-I or II), and plated on YTE, 100 μg/ml ampicillin plates. Colonies were shaken at 37° C. in 2×TY medium, 100 μg/ml ampicillin, 1% glucose to OD550=0.5 to 1.0. Cells were pelleted, washed once in 2×TY medium, resuspended in medium with 100 μg/ml ampicillin, 1 mM isopropyl β-D-thiogalactoside (IPTG), and grown for a further 16 hours. Cells were pelleted and the supernatant, containing the secreted chains, used directly in ELISA.
- The phagemid pHEN1 has the advantage over phage fd-CAT2, in that antibody can be produced either for phage display (by growth in supE strains of E. coli) or as a tagged soluble fragment (by growth in non-suppressor strains), as a peptide tag (example 24) and amber codon were introduced between the antibody and g3p. Secretion of soluble Fab fragments from pHEN1-II or scFv fragments from pHEN1-I was demonstrated after growth in E. coli HB2151 and induction with IPTG using Western blots (
FIG. 29 ). For detection of secreted proteins, 10 μl supernatant of induced cultures were subjected to SDS-PAGE and proteins transferred by electroblotting to Immobilon-P (Millipore). Soluble heavy and light chain were detected with goat polyclonal anti-human Fab antiserum (Sigma) and peroxidase conjugated rabbit anti-goat immunoglobulin (Sigma), each at a dilution of 1:1000. The tagged VK domain was detected with 9E10 antibody (1:1000) and peroxidase conjugated goat anti-mouse immunoglobulin (Fc specific) (1:1000) (Sigma) or with a peroxidase labelled anti-human CK antiserum (Dako). 3,3′-diaminobenzidine (DAB; Sigma) was used as peroxidase substrate (Harlow E., et al. 1988 Supr). With the scFv, the fragments were detected using the 9E10 anti-myc tag antibody (data not shown). With the Fab, only the light chain was detected by 9E10 (or anti-human CK) antibody, as expected, while the anti-human Fab antiserum detected both heavy and light chains. Binding of the soluble scFv and Fab fragments to phOx-BSA (but not to BSA) was also demonstrated by ELISA (Table 5B). Thus scFv and Fab fragments can be displayed on phage or secreted as soluble fragments from the same phagemid vector. - Increased Sensitivity in ELISA Assay of Lysozyme Using FDTscFvD1.3 as Primary Antibody Compared to Soluble scFvD1.3
- In principle the use of phage antibodies should allow more sensitive immunoassays to be performed than with soluble antibodies. Phage antibodies combine the ability to bind a specific antigen with the potential for amplification through the presence of multiple (ca.2800) copies of the majorcoat protein (g8p) on each virion. This would allow the attachment of several antibody molecules directed against M13 to each virion followed by the attachment of several molecules of peroxidase-conjugated anti-species antibody (anti-sheep) IgG in the case below). Thus for every phage antibody bound to antigen there is the potential for attaching several peroxidase molecules whereas when a soluble antibody is used as the primary antibody this amplification will not occur.
- ELISA plates were coated overnight at room temperature using 200 μl of 10 fold dilutions of hen egg lysozyme (1000, 100, 10, 1, 0.1 and 0.01 μg/ml) in 50 mM NaHCO3, pH9.6. ELISA was performed as described in example 4 except that (i) incubation with anti-lysozyme antibody was with either FDTscFvD1.3 (pAb; 1011 phage per well; 1.6 mol) or soluble affinity purified scFvD1.3 (18 μg per well; 0.7 nmol) (ii) incubation with second antibody was with 1/100 dilution of sheep anti-M13 serum for FDTscFvD1.3 samples or with or 1/100 dilution of rabbit anti-scFvD1.3 serum (from S. Ward) for soluble scFvD1.3 samples (iii) peroxidase-conjugated rabbit anti-goat immunoglobulin (Sigma; 1/5000) was used for FDTscFvD1.3 samples and peroxidase-conjugated goat anti-rabbit immunoglobulin (Sigma; 1/5000) was used for soluble scFvD1.3 samples. Absorbance at 405 nm was measured after 15h. The results are shown in
FIGS. 30 and 31 . In these figures lysozyme concentrations for coating are shown on a log scale of dilutions relative to 1 μg/ml. (i.e., log =−3=1 mg/ml; log=2=0.01 μg/ml) - Higher signals were obtained with FDTscFvD1.3 at all concentrations of lysozyme (
FIG. 31 ) but the difference was very marked at the greatest dilutions, where antigen quantities are most limiting (FIGS. 30 and 31 ). This suggests that phage antibodies may be particularly valuable for sandwich type assays where the capture of small amounts of antigen by the primary antibody will generate an amplified signal when phage antibodies directed against a different epitope are used as the second antigen binding antibody. - Direct Rescue and Expression of Mouse Monoclonal Antibodies as Single Chain Fv Fragments on the Surface of Bacteriophage fd.
- The principle is very similar to that described in example 14. It consists of the PCR assembly of single chain antibodies from cDNA prepared from mouse monoclonals. As an example, the rescue and expression of two such antibodies from monoclonals expressing antibodies against the steroid hormone oestriol is described.
- A. RNA Preparation
- RNA can be prepared using many procedures well known to those skilled in the art. In this example, the use of Triton X-100 lysis, phenol/SDS RNase inactivation gave excellent results.
- 1. The mouse monoclonal cells that were used here had been harvested by centrifugation and resuspended in serum free medium. They were then centrifuged and resuspended in saline and after a final centrifugation step, resuspended in sterile water at 1×107 cells per ml. (Normally cells would be washed in PBS buffer and finally resuspended in PBS buffer, but these particular cells were supplied to us as described frozen in water.).
- 2. To 750 μl of cells was added 250 ul of ice cold 4× lysis buffer (40 mM Tris HC1 pH 7.4/4 mM MgCl2/600 mM NaC1/40 mM VRC (Veronyl ribosyl complex)/2% Triton X-100). The suspension was mixed well and left on ice for 5 minutes.
- 3. Centrifugation was carried out at 4° C. in a microfuge at 13000 rpm for 5 min.
- The supernatant is then phenol extracted three times, phenol chloroform extracted three times and finally, ethanol precipitated as described in the materials and methods. The precipitate was resuspended in 50 ul water.
- 4. The optical density of the RNA at 260 nm with a 2.5 ul sample in 1 ml water was measured. The RNA was checked by electrophoresis of a 2 ug sample on a 1% agarose gel. RNA in the range of 32 ug to 42 ug was obtained by this method.
- B. cDNA Preparation
- The method used is the same as that described in example 14. Two cDNA preparations were made. These were from RNA extracted from the monoclonals known as
cell lines 013 and 014 which both express antibodies against the steroid hormone, oestriol. - C. Primary PCRs
- The method used is essentially the same as that described in example 14. The VH region was amplified with the primers VH1BACK and VH1FOR-2. For the Vkappa region, four separate reactions were carried out using the primer VK2BACK and either MJK1FONX, MJK2FONX, MJK4FONX or MJK5FONX. Samples (5 ul) were checked on a 1.5% agarose gel. From this it was observed that for cDNA prepared from the two oestriol monoclonals the primers VK2BACK and MJK1FONX gave the best amplification of the Vkappa region.
- The VH bands and the Vkappa bands amplified with VK2BACK/MJK1FONX were purified on 2% low melting point agarose gels for each monoclonals. The DNA bands were excised from the gel and purified using a dedicated GENECLEAN kit as described in example 14.
- D. Preparation of Linker
- The method used is essentially the same as that described in example 14. In this case, the amplified linker DNA was purified on a 2% agarose gel and recovered from the gel with a dedicated “Mermaid” kit (
BIO 101, GENECLEAN, La Jolla, San Diego, Calif., USA) using the manufacturers instructions. - E. Assembly PCRs
- The method used is essentially the same as that described in example 14. In this case, the assembled PCR product was purified on a 2% agarose gel and recovered from the gel with a dedicated “Mermaid” kit.
- F. Adding Restriction Sites and Work-Up
- The assembled product was “tagged” with Apa LI and Not I restriction sites. The DNA was then digested with Apa LI and Not I to give the appropriate sticky ends for cloning and then purified on a 2% low melting point agarose gel and extracted using a GENECLEAN kit. The method used is the same as that described in example 14.
- G. Cloning into Vector fd-CAT2
- A total of 15 ug of CsC1 purified fd-CAT2 DNA was digested with 100 units of the restriction enzyme Not I (New England Biolabs) in a total volume of 200
ul 1×NEB Not I buffer with 1×NEB acetylated BSA for a total of 3 hours at 37° C. The vector DNA was the treated twice with 15 ul Strataclean (a commercially available resin for the removal of protein), following the manufacturers instructions (Stratagene, 11099 North Torrey Pines Road, La Jolla, Calif., USA). The DNA was then ethanol precipitated and redissolved in TE buffer (Sambrook et al., 1989 supra). The DNA was then digested with 100 units of the restriction enzyme Apa LI (New England Biolabs) in a total volume of 200ul 1×NEB Buffer 4 overnight at 37° C. The vector was then purified with aChroma Spin 1000 column following the manufacturers instructions (Clontech Laboratories Inc, 4030 Fabian Way, Palo Alto, Calif., USA). This step removes the Apa LI/Not I fragment to give cut vector DNA for maximum ligation efficiency. - Ligation reactions were carried out with 2.5-long of the DNA insert and long of vector in a total volume of 10 ul of 1×NEB ligase buffer with 1 ul of NEB ligase (New England Biolabs) at 16° C. overnight (approx 16 hours).
- H. Transformation and Growth
- E. coli strain TG1 was made competent and transformed with the fdCAT2 recombinant DNA as described by Sambrook et al., 1989 Supra. The cells were plated out on LBtet plates (10 g tryptone, 5 g yeast extract, 10 g NaC1, 15 g bacto-agar per litre with 15 ug/ul of tetracycline added just before pouring the plates) and grown overnight.
- Single well isolated colonies were then inoculated into 10 ml of LBtet broth (LB medium with 15 ug/ul of tetracycline) in 50 ml tubes. After overnight growth at 35° C./350 rpm in a bench top centrifuge. The supernatants were transferred to 15 ml centrifuge tubes and 2
ml 20% PEG 8000/2.5M NaC1 added to each. After incubating at room temperature for 20-30 minutes, the recombinant phage was pelleted by centrifugation at 9000 rpm in a Sorval SM24 rotor for 30 minutes. The PEG supernatant was discarded. Any remaining PEG was removed with a pasteur pepette after a brief (2 minutes) centrifugation step. This last step was repeated to make sure that no PEG remained. The phage pellet was then resuspended in 500 ul PBS buffer. This was transferred to a microcentrifuge tube and spun at 13000 rpm to remove any remaining cells. The phage supernatant was transferred to a fresh tube. - I. Assay for Antibody Expression
- Bacteriophage fd recombinants were screened for the expression of antibody against oestriol by ELISA. This method is described in example 6. In this case the following alterations are relevant.
- 1. Microtitre plates were coated overnight with 40 ug/ml oestriol-6 carboxymethyloxime-BSA (Steraloids, 31 Radcliffe Road, Croydon, CRO 5QJ, England).
- 2. 1st antibody was the putative phage anti oestriol antibody. 50 ul of phage in a final volume of 200 ul of sterile PBS combining 0.25% gelatin was added to each well.
- 3. 2nd antibody was sheep anti M13 at 1:1000 dilution.
- 4. 3rd antibody was peroxidase conjugated rabbit anti goat immunoglobulin.
- Recombinants expressing functional antibody were detected by incubation with the
chromogenic substrate 2′2′ axinobis (3-ethyl benzthiazoline sulphonic acid). The results are shown inFIGS. 32 and 33 . - Kinetic Properties of Alkaline Phosphatase Displayed on the Surface of Bacteriophage fd
- This example demonstrates that kinetic properties of an enzyme expressed on phage are qualitatively similar to those in solution. Bacteriophage fd displaying alkaline phosphatase fusions of
gene 3 with either the native arginine (see example 31) or the mutant residue alanine at position 166 (see example 11) were prepared by PEG precipitation as described in the materials and methods. - The kinetic parameters of alkaline phosphatase expressed on the surface of fd phage were investigated in 1M Tris/HC1, pH8.0 at 20° C. with 1 ml 4-nitrophenyl phosphate as substrate. The reactions were initiated by the addition of 100 μl of a phage-alkaline phosphatase fusion preparation, 50 fold concentrated with respect to the original culture supernatant. The rate of change of absorbance was monitored at 410 nm using a Philips 8730 spectrophotometer and the initial reaction rate calculated using a molar absorbance of 16200 1/mol/cm. For the fdphoAla 166 enzyme but not fdphoArg166 a lag phage was seen following this addition, the reaction rate accelerating until a steady state was obtained after approximately 60 to 90 secs. This steady state rate was used for determination of kinetic parameters. No deviation form Michaelis Menten kinetics was apparent for either phage enzyme. Values of Km and kcat were derived from plots of s/v against s and are shown in Table 6.
- Because of the difficulty in establishing the relationship between the number of phage particles an the number of active enzyme dimers formed on the phage kcat values are expressed not as absolute values, but as relative values between the two enzyme forms. Western blots (carried out as in example 31 using antig3p antiserum) of the phage enzyme preparations used in this experiment showed approximately equal intensities for the full length fusion band with the Arg166 and Ala166 enzymes when detected using antibody directed against gene3. In these preparations the intact fusion represents approximately 30% of the detected material. The two preparations were therefore assumed to be expressing approximately the same concentrations of intact fusions.
- Table 6 summarises the kinetic data from this experiment and compares it with data from Chaidaroglou, A. et al (Biochemistry 27, 8338-8343 (1988)) obtained with soluble preparations of the wild type and mutant enzyme forms. The same substrate and assay conditions were used in both experiments. Soluble alkaline phosphatase was also tested in parallel in our experiments (Km=8.5 μM; kcat=3480 mol substrate converted mol enzyme−1 min−1).
- The effect of mutating arginine at position 166 to alanine is qualitatively similar for the phage enzyme as for the soluble enzyme. Km is increased about 15 fold and the relative kcat is decreased to 36% of that for wild type.
- This increased Km would reflect a reduction in substrate affinity in the phage enzyme on mutation of Arg166, as was proposed for the soluble enzyme (Chaidaroglou et al, 1988 supra), assuming the same kinetic mechanism applies. There are, however, some quantitative differences in the behaviour of Km of the phage enzyme. The Km of 73 μM observed for fdphoArg166 compares with a Km of 12.7 μM for the free enzyme; the Km for fdphoAla166 is 1070 μM whereas the free mutant enzyme has a Km of 1620 μM. One can speculate that the higher Km for fdphoArg 166 and the lower Km for fdphoAla166, compared to the soluble enzymes result from the ‘anchored’ alkaline phosphatase fusion molecules interacting to form dimers in a different manner to the enzyme in free solution.
- The relative values of kcat for the Arg166 and Alal66 forms are however very similar for both the phage enzymes and the soluble enzymes, a reduction occurring on mutation to 35 to 40% of the value for the native enzyme. The rate limiting step, determining kcat, for soluble phoArg166 is thought to be dissociation of non-covalently bound phosphate from the enzyme (Hull W. E. et al., Biochemistry, 15, 1547-1561 1976). Chaidaroglou et al, (1988) supra suggest that, for the soluble enzyme, mutation of Arg166 to alanine alters additional steps, one of which may be hydrolysis of the phosphoenzyme intermediate. The similarity in the reduction in kcat on mutation of Arg166 to alanine for the phage enzymes suggests that the same steps may be altered in a quantitatively similar manner in the mutant phage enzyme as in the mutant soluble enzyme.
- Thus, enzymes displayed on phage show qualitatively similar characteristics to soluble enzymes.
- Demonstration Using Ultrafiltration that Cloned Alkaline Phosphatase Behaves as Part of the Virus Particle
- The construct fdphoAla166 (derived in example 11) was converted back to the wild type residue (arginine) at position 166 by in vitro mutagenesis (Amersham International) using the printer
APARG166: 5′ TAGCATTTGCGCGAGGTCACA 3′.(SEQ ID NO:51)
This construct with the wild type insert was called fdphoArg166. - E. coli TG1 or KS272 cells (cells with a deletion in the endogenous phoA gene, Strauch and Beckwith, 1988 Supra) containing either fd-phoAla166, fdphoArg166 or fd-CAT2 were grown for 16 hours at 37° C. in 2×TY with 15 μg/ml tetracycline. Concentrated phage were prepared as follows.
- Phage-enzyme cultures are clarified by centrifugation (15 min at 10,000 rpm, 8×50 ml rotor, sorval RC-5B centrifuge). Phage are precipitated by adding ⅕
volume 20% polyethylene glycol, 2.5 M Nacl, leaving for 1 hr at 4° C., and centrifuging (as above). Phage pellets are resuspended in 10 mM Tris-HC1, pH 8.0 to 1/100th of the original volume, and residual bacteria and aggregated phage removed by centrifugation for 10 to 15 minutes in a bench microcentrifuge at 13000 rpm at 4° C. - SDS/Polyacrylamide gel electrophoresis and western blotting were basically as described previously (example 2). Denatured samples consisting of 16 μl of a 50 fold concentrate of phage were separated using a 10% SDS/polyacrylamide gel and detected with polyclonal antiserum raised against either E. coli alkaline phosphatase (Northumbria Biologicals, South Nelson Industrial Estate, Cramlington, Northumberland, NE23 9HL) or against the minor coat protein encoded by gene 3 (from Prof. I. Rasched, Universitat Konstanz, see Stengele et al, 1990) at 1 in 1000 dilution. This was followed by incubation with peroxidase-conjugated goat-anti-rabbit immunoglobulin (
Sigma 1 in 5000) and detection with the ECL Western blotting system (Amersham International). - The presence of fusion proteins was confirmed by western blotting of proteins from phage particles derived from fd-phoAla166 (phage-enzyme) or fd-CAT2 (vector phage). Detection with antiserum raised against the
gene 3 protein reveals a product of apparent relative molecular mass (Mr) of 63,000 in vector phage (FIG. 34E ). Although this is different from the predicted molecular weight based on the amino acid sequence (42,000), the natural product ofgene 3 has previously been reported to exhibit reduced mobility during electrophoresis (Stengele et al, 1990). - In the fd-phoAla166 sample the largest band has an apparent Mr of 115,000, (
FIG. 34 ). Taking into account the aberrant mobility of thegene 3 portion of the fusion, this is approximately the size expected from fusing with an alkaline phosphatase domain of 47 kD. This analysis also reveals that a proportion of the Gene3 reactive material in this phage-enzyme preparation is present at the size of the native gene3 product, suggesting that degradation is occurring. In the preparation shown inFIG. 34 , approximately 5-10% of thegene 3 fusions are intact. In more recent preparations and in all the preparations used in this example and example 32, approximately 30-60% of fusions are full length. - The protein of Mr 115,000 is the major protein observed in Western blots of phage-enzyme derived from TG1 cells when probed with antiserum raised against E. coli alkaline phosphatase (anti-BAP), confirming the assignment of this band to intact fusion. Further, when phage enzyme is prepared using KS272 cells, which have a deletion in the endogenous phoA gene (Strauch & Beckwith, 1988, supra.) it is also the major band. There are additional bands at Mr 95000 and 60000 reactive with anti-BAP antiserum which may indicate degradation of the fusion product.
- The anti-BAP antiserum also reacts wit material running with the dye front and with a molecule of Mr 45,000 but evidence suggests that this material is not alkaline phosphatase. This pattern is detected in PEG precipitated vector phage samples (
FIG. 34C ) and is not therefore contributed by protein expressed from the cloned phoA gene. These bands are detected in culture supernatants of cells carrying fd-CAT2 but is not detected in the supernatant of uninfected cells (not shown) and so either represents cross-reactivity with phage encoded material or with a PEG precipitable cellular component leaked from infected cells (Boeke et al, Mol. Gen. Genet. 186, 185-192 1982). Although the fragment of Mr, 45,000 is close to the size of free alkaline phosphatase (47,000), it is present in phage preparations from KS272 cells which have a deletion in the phoA locus. Furthermore its mobility is different from purified alkaline phosphatase and they can be distinguished by electrophoresis (FIG. 34 ). - Ultrafiltration was used to confirm that the fusion protein behaved as though it were part of a larger structure, as would be expected for an enzyme bound to a phage particle. Phage samples (100 μl of a 50 fold concentrate) were passed through ultrafiltration filters with a nominal molecular weight limit of 300000 daltons (Ultrafree-MC filters, Millipore) by centrifugation for 5 to 15 minutes at 13,000 r.p.m. in an MSE microcentaur microfuge. Retained material was recovered by resuspending in 100 μl of 10 mM Tris, pH 8.0.
- Phage-enzyme or free alkaline phosphatase (83 ng) mixed with vector phage were passed through filters with a nominal molecular weight limit of 300,000 daltons (Ultrafree-MC filters, Millipore).
FIG. 35A again shows that the band of Mr, 115,000 is the major product reactive with anti-BAP antiserum. This and the other minor products reactive with anti-BAP are present in material retained by the ultrafiltration membrane. Analysis of retained and flow through fractions of phage preparations derived from KS272 demonstrates that different molecular species are being separated by the ultrafiltration membranes.FIG. 35B shows the protein of Mr 115,000 is retained by the filter whereas the putative degradation products of Mr 95,000 and 60,000 found in phage preparations derived from KS272 cells, are not retained. - In mixture of alkaline phosphatase and vector phage
FIG. 35B (c-f), free alkaline phosphatase (dimer size of 94,000 daltons) is detected in the flow through as a monomer band with Mr 47,000 on denaturing polyacrylamide gels (FIG. 35B ), while the cross reactive molecule found in vector phage preparations (Mr 45,000) is in retained on the filter (FIG. 35B ). This suggests that the cross reactive molecule is part of the phage particle and underlines the fact that the ultrafiltration membranes are effecting a separation. Thus the expected fusion band in this phage-enzyme is present in material retained on ultrafiltration membranes demonstrating that it is part of a larger structure as would be expected for viral bound enzyme. - Catalytic activity has been demonstrated on phage particles expressing alkaline phosphatase. Table 7 shows that the wild type alkaline phosphatase gene expressed on phage (fd-phoArg166) has a specific activity (moles of substrate converted per mole of viral particles) of 3,700/min. This is close to the turnover value of 4540/min found for purified alkaline phosphatase by Malamy and Horecker,
Biochemistry 3, 1893-1897 1964). - Chaidaroglou et al, 1988 supra have shown that substituting alanine for arginine at the active site (residue 166) leads to a reduction in the rate of catalysis. Preparations of phage displaying alkaline phosphatase with this mutation derived from TG1 and KS272 show reduced specific activities of 380 and 1400 mol substrate converted/mol phage/min respectively. Enzyme activity was measured in the retained and flow-through fractions prepared by ultrafiltration, shown in
FIG. 35 (A) andFIG. 35 (B). The bulk of activity from phage-enzyme was retained on the filters whereas the majority of activity from free enzyme passes through. Therefore, the enzyme activity in these fusions behaved as would be expected for virally associated enzyme (not shown). Little or no catalytic activity is measured in preparations of vector phage from either TG1 or KS272 cells (Table 7), indication that the catalytic activities above are due to phage enzyme and not contamination with bacterial phosphatase. Addition of phage particles to soluble enzyme does not have a significant effect on activity (Table 7). - Therefore, both the catalytic and immunochemical activity of alkaline phosphatase have been demonstrated to be due to enzyme which is part of the phage particle.
- Affinity Chromatography of Phage Alkaline Phosphatase
- Affinity chromatography, using the specific binding properties of enzymes has proved to be a very powerful method for their purification. The purification of phage-enzymes by this approach would enable the genetic material encoding the enzyme to be isolated with the enzyme itself. Thus, mutagenesis of cloned enzymes expressed on the surface of filamentous bacteriophage will lead to a whole population of enzyme variants, from which variants with desired binding properties could be isolated.
- Soluble alkaline phosphatase (from calf intestine) has been purified by binding to immobilised arsenate (a competitive inhibitor), and eluting with inorganic phosphate, which is a product (and competitive inhibitor) of the enzyme reaction (Brenna, O. et al, Biochem. J. 151 291-296 1975). The applicants have determined that soluble alkaline phosphatase from E. coli is also retained by this matrix (not shown). In this example it is demonstrated that phage displaying E. coli alkaline phosphatase binds to arsenate-Sepharose and can be specifically eluted.
- Arsenate-Sepharose was prepared by coupling 4-(p-aminophenylazo)phenyl arsonic acid to tyraminyl-Sepharose according to the method of Breena et al, (1975; supra). Affinity chromatography of phage enzyme fdphoArg166 (example 31) was carried out in a disposable chromatography column with a 0.5 ml column volume. Columns were prewashed with 110 volumes of column buffer (100 mM Tris pH 8.4, 1 mM MgCl2, 0.1 mM ZnCl2, 0.1
% Tween 20, Brenna et al, 1975, supra.) 1 ml of a 40 fold concentrate of phage-enzyme (in column buffer; prepared as in example 31) was loaded and washed through with 100 volumes of column buffer. Bound phage-enzyme was eluted with 5 mls of column buffer containing 20 mM NaHPO4. The eluate and wash fractions were quantitated by dot blotting onto nitrocellulose and comparing with known amounts of phage-enzyme. The blots were detected using sheep anti-M13 antiserum (gift from M. Hobart), anti-sheep peroxidase (Sigma) and enhanced chemiluminescent substrate (Amersham). A range of exposures were taken. - Table 8 shows the results of affinity chromatography of phage displaying alkaline phosphatase on arsenate-Sepharose. In separate experiments phage particles expressing either mutant (fdphoAla 166; example 11) and or wild type (fdphoArg 166) forms are retained on arsenate-Sepharose and eluted with inorganic phosphate. Approximately 0.5 to 3% of added phage enzyme particles loaded (‘input phage’) were specifically eluted with phosphate (‘output phage’) compared to only 0.05% of vector particles. Arsenate is a competitive inhibitor with Ki of 20 μM with respect to 4-nitrophenyl phosphate. Phage particles antibodies have previously been isolated on the basis of interactions with similar affinities (example 23).
- This association is in within the range of a large number of enzyme-ligand interactions suggesting wide applicability for this approach.
- Table 8 also shows that the infectivity of phage particles expressing enzyme is reduced with compared with vector phage particles. This makes titration of infectious particles an inappropriate means of quantitating the number of phage enzyme particles. For this reason the number of phage were measured by dot blotting and phage were detected with anti-M13 antiserum as above.
- Whereas, overall recovery of catalytic activity may be an important consideration in enzyme purification, this is not critical with phage-enzymes. Even if only low levels of phage-enzyme bind to and are specifically eluted from affinity columns, this will generate clones which can subsequently be grown up in bulk as phage-enzymes or can be transferred to expression vectors yielding soluble products.
- PCR Assembly of DNA Encoding Fab Fragments of an Antibody Directed Against Oxazolone
- Example 25 showed that genes encoding Fab fragments could be subcloned into vectors fdCAT2 and pHEN1 and the protein domains displayed on the surface of phage with retention of binding function. This example shows that the VHCH and VKCK domains can be amplified separately and then joined by a linker allowing the expression of the light chain as a geneIII protein fusion and the VHCH fragment as a soluble molecule. A functional Fab fragment is then displayed on phage by association of these domains. The assembly process, described in this example, is required for display of a library of Fab fragments derived from the immune repertoire if both heavy and light chain domains are to be encoded within a single vector.
- The VHCH1 and VKCK domains of a construct (example 25; construct II in pUC19) derived from antibody NQ10 12.5 directed against 2-phenyl-5-oxazolone were amplified using PCR. For cloning into the vector fdCAT2 the oligonucleotides VH1BACKAPA (example 25) and HuIgG1-4 CH1FOR (example 40) were used to amplify the VHCH1 domains. For cloning into pHEN1 VH1BACKSFH5 (example 25) replaced VH1BACKAPA for this amplification. For cloning into both vectors the VKCK domains were amplified using VK2BACK (example 25) and CKNOTFOR (example 40). A linker oligonucleotide fragment containing the bacteriophage fd
gene 8 terminator and thefd gene 3 promoter was prepared by amplifying the region containing them from the vector fdCAT2 by PCR using the oligonucleotides.VK-TERM- FOR 5′ TGG AGA CTG GGT GAG CTC AAT GTC (SEQ ID NO:52) GGA GTG AGA ATA GAA AGG 3′(overlapping with VK2BACK and CH1-TERM- BACK 5′ AAG CCC AGC AAC ACC AAG GTG GAC (SEQ ID NO:53) AAG AAA GTT GAG CCC AAA TCT AGC TGA TAA ACC GAT ACA ATT AAA GGC 3′
(Overlapping with HuIgG1-4 CH1-FOR) - Assembly of the Fab fragment from the amplified VHCH1 and VKCK domains and the linker prepared as above was as described in example 14E except that the primers VH1BACKAPA (when cloning into fdCAT2) or VH1BACKSFH5 (when cloning into pHEN1) and CKNOTFOR were used for the final reamplification, thereby introducing restriction sites for cloning into fdCAT2 (Apa1I-NotI) or pHEN1 (SfiI-NotI) the assembled Fab fragment is shown in
FIG. 34 . No assembled product was seen in the absence of linker. An assembled scFv prepared according to example 14 is shown for comparison. - Phage antibodies were prepared as in example 25 and ELISA was performed with oxazolone as antigen according to example 6. Results were as expected for Fab fragments cloned in both fdCAT2 and pHEN1 samples, phage particles bound to oxazolone as detected by a positive ELISA signal.
- Construction of a Gene III Deficient Helper Phage
- To fully realise the potential of the phagemid cloning system, a helper phage lacking gene III is desirable. Rescue of gene III fusions with such a helper phage would result in all the progeny phagemids having a gene III fusion on their capsid, since there would be no competition with the wild type molecule.
- Control over the number of fusion molecules contained on each phage will provide particularly useful. For example, a gene III deficient helper phage can be used to rescue low affinity antibodies from a naive repertoire, in which high avidity will be necessary to isolate those phage bearing the correct antibody specificity. The unmutated helper phage can then be used when higher affinity versions are constructed, thereby reducing the avidity component, and permitting selection purely on the basis of affinity. This will prove a surprisingly successful strategy for isolation and affinity maturation of antibodies from naive libraries.
- The strategy chosen to construct the helper phage was to partially delete gene III of M13K07 using exonuclease Bal 31. However, phage lacking gene III protein are non-infective so an E. coli strain expressing gene III was constructed. Wild type M13 gene III was PCR-amplified with primers gIIIFUFO and gIIIFUBA, exactly as described in example 24. The PCR product was digested with Eco R1 and Hind III and inserted into Eco R1 and Hind III-cut pUC19 (not a phagemid as it lacks the filamentous phage origin of SS DNA replication) under control of the lac promoter. The plasmid was transformed into E. coli TG1, and the resulting strain called TG1/pUC19gIII. This strain provides gIII protein in trans to the helper phage.
- There is a single unique Bam HI site in M13KO7, which is approximately in the centre of gIII. Double-stranded M13K07 DNA was prepared by alkaline lysis and caesium chloride centrifugation (Sambrook et al, et supra. 1989); twenty pg of DNA was cut with Bam H1, phenol extracted and ethanol precipitated then resuspended in 50 μl of Bal 31 buffer (600 mM NaC1, 20 mM Tris-HC1 pH 8.0, 12 mM CaCl2, 12 mM MgC12 and 1 mM EDTA) and digested for 4 minutes with 1 unit of Bal 31 (New England BioLabs). This treatment removed approximately 1 Kb of DNA. EGTA was added to 20 mM and the reaction phenol extracted and ethanol precipitated prior to purification of the truncated genome on an agarose gel. The DNA was repaired with klenow enzyme and self-ligated with T4 DNA ligase (New England BioLabs).
- Aliquots of the ligation reaction were transformed into competent TG1/pUC19gIII and plated on SOB medium containing ampicillin at 100 μg/ml and kanamycin at 50 μg/ml. Colonies were screened for the presence of a deletion by PCR with primers gIIIFUBA and KSJ12 (CGGAATACCCAAAAGAACTGG) (SEQ ID NO:54).
-
KSJ 12 anneals to gene VI which is immediately downstream of gIII in the phage genome, so distinguishing gIII on the helper phage from that resident on the plasmid. Three clones gave truncated PCR products corresponding to deletions of ca. 200, 400 and 800 bp. These clones were called M13K07gIII Δ Nos - M13K07 gIII Δ Nos. 1, 2 and 3 were cultured and the resulting helper phage tested for their ability to rescue an antibody gIII fusion (scFv D1.3) by ELISA, exactly as described in example 18. As shown in
FIG. 37 , only one clone, M13K07 gIII Δ No3 was found to rescue the antibody well; in fact the signal using this helper was greater than that observed with the parent M13 KO7. M13KO7 gIIIΔ No3 rescued phagemids should have a much higher density of antibody fusions on their surfaces. That this was indeed the case was demonstrated when the phage used in this ELISA were analysed by Western blotting with anti gIII protein antiserum (FIG. 38 ). This analysis enables estimation of the amount of gIII fusion protein versus free gIII protein present on the phage(mid) particles. - Only a minute fraction of the gIII protein on the M13K07-rescued material is present as an intact fusion (
FIGS. 38A-38B ). The fusion protein band is induced by IPTG, so is indisputably that synthesised by the phagemid. As expected, even when the lac promoter driving gIII fusion protein synthesis is fully induced (100 μM IPTG), wild type gIII protein, at a lower copy number and driven from a far weaker promoter, predominates. This is in contrast to the pattern generated by the same clone rescued with M13K07 gIIIΔNo3, and the pattern generated by fd CAT2-scFv D1.3. In both of these latter cases, there is no competition with wild-type gIII and the fusion protein band is correspondingly stronger. - It is worthy of note that construction of M13K07 gIII Δ No3 was immensely inefficient: one clone from 20 μg of starting DNA. Moreover, the yield of gIII helper phage from overnight cultures is extremely low ca.106 cfu/ml compared with ca. 106 cfu/ml for the parental phage. Despite this, M13K07 gIII No3 rescues the phagemid as well as the parental phage, as judged by the number of phagemid particles produced after overnight growth. This indicates that trans replication and packaging functions of the helper are intact and suggest that its own replication is defective. Hence it may be that inactivation of gIII is normally toxic to the host cell, and that M13K07 gIII Δ No3 was isolated because of a compensating mutation affecting, for example, replication. Phage fd-tet is unusual in that it tolerates mutations in structural genes that are normally lethal to the host cell, since it has a replication defect that slows down accumulation of toxic phage products; M13K07 gIIIΔ No3 may also have such a defect.
-
M13K07g IIIΔ No 3 has been deposited at the National Collection of Type Cultures, 61 Colindale Avenue, London, NW9 6HT, UK (Accession No. NCTC 12478). On 28 Jun. 1991, in accordance with the regulations of the Budapest Treaty. It contains a deletion of the M13 genome from bases 1979 to 2768 inclusive (see Van Wezenbeek, P. G. M. F. et al., Gene II p 129-148, 1980 for the DNA sequence of the M13 genome). - Selection of Bacteriophage Expressing scFv Fragments Directed Against Lysozyme from Mixtures According to Affinity Using a Panning Procedure
- For isolation of an antibody with a desired high affinity, it is necessary to be able to select an antibody with only a few fold higher affinity than the remainder of the population. This will be particularly important when an antibody with insufficient affinity has been isolated, for example, from a repertoire derived from an immunised animal, and random mutagenesis is used to prepare derivatives with potentially increased affinity. In this example, mixtures of phage expressing antibodies of different affinities directed against hen egg lysozyme were subjected to a panning procedure. It is demonstrated that phage antibodies give the ability to select for an antibody with a Kd of 2 nM against one with a Kd of 13 nM.
- The oligonucleotides used in this example are shown in the list below:
- Oligonucleotides
VHBHD13APA: 5′-CAC AGT GCA CAG GTC (SEQ ID NO:55) CAA CTG CAG GAG AGC GGT- 3′ VHFHD13: 5′-CGG TGA CGA GGC TGC (SEQ ID NO:56) CTT GAC CCC-3′ HD13BLIN: 5′-GGG GTC AGG GCA GCC (SEQ ID NO:57) TCG TCA CCG-3′ HD13FLIN3: 5′-TGG GCT CTG GGT CAT (SEQ ID NO:58) CTG GAT GTC CGA T-3′ T VKBHD13: 5′-GAC ATC CAG ATG ACC (SEQ ID NO:59) CAG AGC CCA-3′ VKFHD13NOT: 5′-GAG TCA TTC TGC GGC (SEQ ID NO:60) CGC ACG TTT GAT TTC CAC CTT GGT CCC-3′ MURD13SEQ: 5′-GAG GAG ATT TTC CCT (SEQ ID NO:61) GT-3′ HUMD13SEQ: 5′-TTG GAG CCT TAC CTG (SEQ ID NO:62) GC-3′ FDPCRFOR: 5′-TAG CCC CCT TAT TAG (SEQ ID NO:63) CGT TTG CCA-3′ FDPCRBAK: 5′-GCG ATG GGT GTT GTC (SEQ ID NO:64) ATT GTC GGC-3′
Phage displaying scFv fragments directed against lysozyme were derived from cloned Fab fragments in plasmids. - Heavy and light chain variable regions were amplified by the polymerase chain reaction (PCR) from plasmids containing humanized VH-CH1 or VK-CK inserts suitable for production of Fab fragments (gift of J. Foote). The dissociation constant, Kd for different combinations of the two plasmids combined as Fabs, are shown below:
Heavy Chain Plasmid Light Chain Plasmid Kd HuH-1 HuK-3 52 nM HuH-1 HuK-4 180 nM HuH-2 HuK-3 13 nM HuH-2 HuK-4 (not determined)
Primary PCR - The primary PCR of the variable regions was performed by combining the following:
- 36.5 μl Water
- 5 μl PCR buffer (10×)
- 2 μl dNTP (5 mM)
- 2.5 μl Back oligo (10 pmoles/μl) (VHBHD13APA or VKBHD13)
- 2.5 μl Forward oligo (10 pmoles/μl) (VHFHD13 or VKFHD13NOT)
- The reaction is decontaminated by UV irradiation to destroy foreign DNA for 5 minutes, and 1 μl of plasmid DNA added (0.1 μg/μl). The pcr mixture was covered with 2 drops of paraffin oil, and placed on the pcr block at 94° C. for 5 minutes before the addition of 0.5 μl of Taq DNA polymerase under the paraffin. The cycling conditions used were 94° C. 1 min, 40° C. 1 min, 72° C. 1.5 min 17 cycles.
- The linker (Gly4-Ser)3, was amplified from the anti-phOx (2-phenyloxazol-5-one) clone fd-CAT2-scFv NQ11, using the oligos HD13BLIN and HD13FLIN3, with 0.1 μg of plasmid DNA. The PCR cycling used was 94° C. 1 min, 25° C. 1.5 min, for 17 cycles.
- Amplified DNA was purified by running the samples on a 2% low melting point agarose gel at 90 mA, excising the appropriate bands and extracting the DNA using the GENECLEAN II Kit (
BIO 101 Inc.) for the VH and VK, or by using Spin-X filter units (Costar) for the linker. A final volume of 10 μl was used to resuspend the extracted DNA. - PCR Assembly
- Assembly of the four single chain Fv Humanized D1.3 (scFv HuD1.3) constructs was by the process of ‘assembly by overlap extension’ example 14.
- The following were combined:
- 34.5 μl Water
- 5 μl PCR Buffer (10×)
- 2 μl dNTP (5 nM)
- 2.5 μl Back oligo (10 pmoles/μl) (VHBHD13APA)
- 2.5 μl Forward oligo (10 pmoles/μl) (VKFHD13NOT)
- Once again, the reaction is decontaminate by UV treatment for 5 minutes before the addition of 1 μl of the primary PCR products; VH-1 or VH-2, VK-3 or VK-4, plus the linker DNA. The reaction was covered with 2 drops of paraffin, and heated at 94° C. for 5 minutes before the addition of 0.5 μl of Taq Polymerase. The PCR cycling conditions used were 94° C. 1 min, 60° C. 1.5 min, 72° C. 2.5 min for 20 cycles.
- The aqueous layer under the paraffin was extracted once with phenol, once with phenol: chloroform, once with ether, ethanol precipitated, and resuspended in 36 μl of water. To this was added, 5 μl of 10× Buffer for NotI, 5
μl 1 mg/ml BSA, and 4 μl (40 U) of NotI (New England Biolabs). The restriction was incubated at 37° C. overnight. - The DNA was ethanol precipitated and resuspended in 36 μl of water, and 5
μl 10×NEB Buffer μl 1 mg/ml BSA, and 2 μl (40 U) of ApaLI (New England Biolabs). This was incubated at 37° C. for 5 hours; a further 2 μl of ApaLI was added and the reaction incubated at 37° C. overnight. - The cut DNA was extracted by gel purification on a 1.3% low melting point agarose gel followed by treatment with GENECLEAN, to yield the insert DNA for cloning.
- Vector fd CAT2 (prepared and digested with ApaLI and NotI as in example 20) and the scFv DNA were ligated as in example 20.
- Analysis of Clones
- Colonies from the ligations were first screened for inserts by PCR screening. The PCR mixture was prepared in bulk by combining 14.8
μL 1×PCR Buffer, 1 μl dNTP (5 mM), 1 μl Back oligo (FDPCRBAK), 1 μl Forward oligo (FDPCRFOR), and 0.2 μl Taq polymerase per colony screened. 20 μl of this PCR mixture was aliquoted into a 96 well Techne plate. The top of a colony was touched with a toothpick and twirled quickly into the PCR mixture and the colony rescued by placing the toothpick in a Cellwell plate (Nunc) containing 250 μl of 2×TY medium. The PCR mixture is covered with 1 drop of paraffin and the plate placed on the block at 94° C. for 10 minutes before cycling at 94° C. 1 minute, 60° C. 1 minute, 72° C. 2.5 minutes. - The clones thus derived were named as below. The affinity of scFv fragments derived the Fab fragments was not determined but previous results suggests that these are closely related although not necessarily identical (R.E. Bird & B.W.
Walker TIBTECH 9 132-137, 1991).Construct Affinity Name Composition of Fab (Kd) TPB1 VH-HuH2-(Gly4- 13 nM (SEQ ID NO:269) Ser)3-VK-HuK3 TPB2 VH-HuH1-(Gly4- 180 nM (SEQ ID NO:270) Ser)3-VK-HuK4 TPB3 VH-HuH2-(Gly4- (Unknown) (SEQ ID NO:271) Ser)3-VK-HuK4 TPB4 VH-HuH1-(Gly4- 52 nM (SEQ ID NO:272) Ser)3-VK-HuK3 - Preparation of phage and ELISA was as described in example 6. The clones generated in fd CAT2 were shown to bind lysozyme as expected.
- Affinity Selection
- Selection of Highest Affinity Binding Phage
- Mixing experiments were performed in which fd-CAT2 scFvD1.3 phage (example 19) were mixed with either fd-CAT2 TPB1, fd-CAT2 TPB2, or fd-CAT2 TKPB4, and used in one round of panning.
- The general method used for affinity selection by panning is that detailed below. Any deviation from this protocol is described at the relevant point. Panning plates were placed on a rocking platform between manipulations.
- Falcon 35 mm Tissue Culture dishes were coated overnight with 1 ml of Lysozyme (various concentrations) dissolved in 50 mM Sodium Hydrogen Carbonate, pH 9.6, and blocked with 2
ml 2% MPBS at room temperature for 2 hours. Phage were prepared in 1ml 2% MPBS and rocked at room temperature for 2 hours. Plates were washed for 5 minutes with 2 ml of the following solutions; 5 times with PBS, PBS-Tween, 50 mM Tris-HC1, pH 7.5; 500 mM Sodium Chloride, 50 mM Tris-HCl, pH 8.5; 500 mM Sodium Chloride, 50 mM Tris-HC1, pH 9.5; 500 mM Sodium Chloride, 50 mM Sodium Hydrogen Carbonated, pH 9.6; 500 mM Sodium Chloride. Phage were then eluted by adding 1ml 100 mM Triethylamine and rocking for 5 minutes before removing the eluate which was neutralised with 100 μl 1.0 M Tris-HC1, pH 7.4. - Plates were coated overnight with Lysozyme at the concentration listed below.
- Colonies from the single round of panning were probed with either MURDSEQ (for fdCAT2 scFvD1.3) or HUMD13SEQ (for fdCAT2 TPB constructs).
- Circles of nitrocellulose (Schleicher & Schuell, BA 85, 0.45 μm) were labelled in pencil and lowered gently onto the colonies derived from the panning experiments and left for one minute. The filters were then pulled off quickly from one edge and placed colony side up on a piece of 3 MM paper (Whatman) soaked in Denaturing solution (500 mM Sodium Hydroxide; 1.5 M Sodium Chloride) for 5 minutes. They were then transferred to 3 MM soaked in Neutralizing Solution (3.0 M Sodium Chloride; 500 mM Tris-HC1, pH 7.5) for 1 minute, and then to 3 MM soaked in 5×SSC; 250 mM Ammonium Acetate for 1 minute. The filters were then air dried before baking in an 80° C. vacuum oven for 30 minutes.
- The oligonucleotide probe was prepared by combining the following:
- 2 μl oligonucleotide (1 pmoles/μl)
- 2 μl γ-32P ATP (3000 Ci/mmole) (Amersham International plc)
- 2
μl 10× Kinase buffer (0.5 M Tris-HC1, pH 7.5; 100 mM Magnesium Chloride; 10 mM DTT) - 12 μl Water
- 2 μl Polynucleotide Kinase (20 Units)
- This was incubated at 37° C. for 1 hour.
- Hybridization was performed in the Techne HB-1 Hybridiser. The baked filters were pre-hybridized at 37° C. in 40 ml of Hybridization Buffer (10
ml 100 mM Sodium pyrophosphate; 180 ml 5.0 M Sodium chloride; 20ml 50× Denharts Solution; 90 ml 1.0 M Tris-HC1, pH 7.5; 24ml 250 mM EDTA; 50ml 10% NP40; made to 1 litre with water; 60.3 mg rATP; 200 mg yeast RNA (Sigma)), for 15 minutes before the addition of the 20 μl of the kinased oligo. The filters were incubated at 37° C. for at least one hour, and then washed 3 times with 50 ml of 6×SSC at 37° C. for 10 minutes (low stringency wash). Filters were air dried, covered with Saran wrap and exposed overnight with Kodak X-AR film. -
FIG. 39 , summarizes the results from panning experiments using a mixture of the high affinity fd-CAT2 scFv D1.3 phage (Kd-2 nM) and the fd-CAT2 TPB4 construct (Kd-52 nM). - At a coating concentration of 3000 μg/ml Lysozyme, little or no enrichment could be obtained. It was however, possible to get enrichment for the scFv D1.3 phage when a lower concentration of Lysozyme was used for coating the plates. The best enrichment value obtained was from 1.5% fd-CAT2 scFv D1.3 in the starting mixture, to 33% fd-CAT2 scFv D1.3 in the eluted faction, on a plate coated overnight with 30 μg/ml Lysozyme.
- Enrichment for the high affinity scFv D1.3 phage over the fd-CAT2 TPB1 phage (Kd-13) nM, could only be shown from experiments where the plates had been coated overnight with low concentrations of Lysozyme, as shown in
FIG. 40 . - In summary, single chain Fv versions of a series of humanized D1.3 antibodies have been constructed in phage fd-CAT2. By affinity selection of fd-CAT2 phage mixtures, by panning in small petri dishes, it was shown that the high affinity scFv D1.3 phage, could be preferentially selected for against a background of lower affinity scFv HuD1.3 phage.
- Expression of Catalytically Active Staphylococcal Nuclease on the Surface of Bacteriophage fd
- Examples 11 and 12 showed that alkaline phosphatase from E. coli can be expressed as a catalytically active enzyme on the surface of bacteriophage fd. Here we show that Staphylococcal nuclease can also be expressed in a catalytically active form suggesting that this methodology may be general.
- The gene for the enzyme Staphylococcal nuclease (SNase) was amplified from M13 mp18-SNase (Neuberger, M. S. et al, Nature, 312, 604-608, 1984) by PCR using primers with internal ApaLI (5′-GGAATTCGTGCACAGAGTGCAACTTCAACTAAAAAATTAC-3′) (SEQ ID NO:65) and NotI (5′-GGGATCCGCGGCCGCTTGACCTGAATCAGCGTTGTCTTCG-3′) (SEQ ID NO:66) restriction sites, cloned into phage vector fd-CAT2 after digestion with ApaLI-NotI restriction enzymes and the nucleotide sequence of the SNase gene and junctions with gene III checked by DNA sequencing. The fd-tet-SNase phage was prepared from the supernatant of infected E. coli TG1 cultures by three rounds of PEG precipitation, and the fusion protein demonstrated by SDS-gel electrophoresis and Western blotting using rabbit anti-g3p antiserum (Prof. I. Rasched, Konstanz) and peroxidase-labelled goat anti-rabbit antibodies (Sigma) (
FIG. 41 ) as described in example 27. As well as the fusion protein band (calculated Mr 59749, but runs at a higher position due to the aberrant g3p behaviour), a smaller proteolytic product is seen. - The fusion protein was shown to be catalytically active by incubation of the fd-tet-SNase phage (4×109 tetracycline resistant colonies [TU]) with single stranded DNA (1 μg) for 1 hr at 37° C. in the presence of Ca2, and analysis of the digest by agarose gel electrophoresis (
FIG. 42 ). Nuclease activity was not detected with the parent fd-CAT2 (2×1010 TU) phage alone or after three rounds of PEG precipitation of mixtures of fd-CAT2 (2×1010 TU) with SNase (0.7 μg). Thus the nuclease activity results from the display of the enzyme on the surface of the phage and not from co-precipitated or soluble SNase set free by degradation of the fusion protein. The nuclease activity of fd-tet-SNase (FIG. 42 ) lies in the same order of magnitude, (2×108 TU and assuming three copies of SNase per TU) as an equimolar amount of SNase (0.03 ng or 109 particles), and like the authentic SNase was dependent on Ca2+, since incubation with 40 mM MgCl2 and 25 mM EGTA blocked activity (not shown). - Display of the Two Aminoterminal Domains of Human CD4 on the Surface of fd Phage
- The protein CD4, a member of the immunoglobulin superfamily, is a cell surface receptor involved in MHC class II restricted immune recognition. It is also recognised by the protein gp120 derived from the human immunodeficiency virus (AIDS virus). The first two domains (named V1 and V2, residues 1-178) of the surface antigen CD4 were amplified from pUC13-T4 (gift from T. Simon) containing the human cDNA of CD4, by PCR using primers with internal ApaLI (5′-GGA ATT CGT GCA CAG AAG AAA GTG GTG CTG GGC AAA AAA GGG G-3′) (SEQ ID NO:67) and NotI (5′-GGG ATC CGC GGC CGC AGC TAG CAC CAC GAT GTC TAT TTT GAA CTC-3′) (SEQ ID NO:68) restriction sites. After digestion with these two enzymes, the PCR-product was cloned into fdCAT2, and the complete nucleotide sequence of the CD4-V1V2 DNA and junctions with gene III checked by dideoxy sequencing using oligonucleotides fd-seq1 (5′-GAA TTT TCT GTA TGA GG) (SEQ ID NO:69), CD4-seq1 (5′-GAA GTT TCC TTG GTC CC-3′) (SEQ ID NO:70) and CD4-seq2 (5′-ACT ACC AGG GGG GCT CT-3′) (SEQ ID NO:71). In the same way, a fd-CD4-V1 version was made, linking residues 1-107 to the N-terminus of gene III, using previously mentioned primers and
oligonucleotide 5′-GGG ATC CGC GGC CGC GGT GTC AGA GTT GGC AGT CAA TCC GAA CAC-3′ (SEQ ID NO:72) for amplification, PCR conditions and cloning were essentially as described in example 15 except that digestion was with ApaLI and NotI (used according to the manufacturers instructions). - Both fd-CD4-V1 and fd-CD4-V1V2 phages were prepared from the supernatant of infected E. coli TG1 cultures by three rounds of PEG precipitation, thereby concentrating the sample 100-fold for ELISA analysis. The fusion protein was detected in a Western blot (results not shown) with a rabbit anti-gene III antiserum, and revealed bands of the expected size.
- Binding of the CD4 moiety to soluble gp120 (recombinant HIV-IIIB gp120 from CHO cells, ADP604, obtained from the Aids Directed Programme, National Institute for Biological Standards and Controls, South Mimms, Potters Bar, UK) was analysed in an ELISA, using 5 μg/ml gp120 for coating (overnight, in PBS). Anti-M13 antiserum was used to detect bound phage; all other conditions were as in Example 9.
FIG. 43 shows the ELISA signals of wild-type phage (fd-tet) and both CD4-phages. Both CD4-phages can bind gp120, but fd-CD4-V1V2 binds much stronger to gp120 than fd-CD4-V1. The binding competitors, soluble CD4 (recombinant soluble CD4 from Baculovirus, ADP 608; from the AIDS Directed Programme) (25 μg/ml) or soluble gp120 (20 μg/ml), added together with the 50 μl phage stock sample during the ELISA, decreased the signal to background level. These results indicate that phage binding to gp120 is mediated by the CD4 molecule displayed at its surface, and that binding is stronger when the two aminoterminal domains of CD4 are presented. - Thus, CD4 is a cell surface receptor molecule which is active when displayed on bacteriophage fd. Like the PDGF-BB receptor, the functional display of which is described in examples 15 and 16, CD4 is a member of the immunoglobulin superfamily and this result suggests that this class of molecule may be generally suitable for display on the surface of phage.
- Generation and Selection of Mutants of an Anti-4-hydroxy-3-nitrophenylacetic Acid (NP) Antibody Expressed on Phage Using Mutator Strains
- It will sometimes be desirable to increase the diversity of a pool of genes cloned in phage, for example a pool of antibody genes, or to produce a large number of variants of a single cloned gene. There are many suitable in vitro mutagenesis methods. However, an attractive method, particularly for making a more diverse population of a library of antibody genes, is to use mutator strains. This has the advantage of generating very large numbers of mutants, essentially limited only by the number of phage that can be handled. The phage display system allows full advantage to be taken of this number to isolate improved or altered clones.
- Nucleotide sequences encoding an antibody scFv fragment directed against 4-hydroxy-3-nitrophenylacetic acid (NP), scFvB18, derived as in example 14 from a monoclonal antibody against NP were cloned into fdCAT2 using ApaLI and NotI restriction sites as in example 11 to create fdCAT2scFvB18 or into fdDOGKan (fdCAT2 with its tetracycline resistance gene removed and replaced by a kanamycin resistance gene) using PstI and NotI restriction sites to create fdDOGKanscFvB18 or into the phagemid vector pHEN1 using the restriction sites SfiI and NotI as a fusion protein with gene III to create pHEN1scFvB18.
- The following mutator strains (R. M. Schaaper & R. L. Dunn, J. Mol. Biol., 262, 1627-16270, 1987; R. M. Schaaper, Proc. Natl. Acad., Sci., U.S.A., 85, 8126-8130, 1988) were used:
- NR9232: ara, thi, mutD5-zaf13::Tn10, prolac, F'prolac
- NR9670: ara, thi, azi, mutT1, leu::Tn10, prolac
- NR9292: ara, thi, mutH101, prolac, F'prolac
- NR9084: ara, thi, mutT1, azi, prolac, F'prolacI− Z− ΔM15 M15
- NR9046: ara, thi, supE, rif, nalA, metB, argE(am), prolac, F'prolac
- were kind gifts of Dr. R. M. Schaaper (Department of Health & Human Services, N1H, PO Box 12233, Research Triangle Park, N.C. 27709)
- NR9046mutD5: NR9046 mutD5::Tn10
- NR9046mutT1: NR9046 mutT1::Tn10
- were constructed by P1 transduction according to standard procedures. Mutator strains were transfected with fdCAT2scFvB18 of fdDOGKanscFvB18 and transfectants selected for antibiotic resistance. Transfectants were grown for 24 h at 37° C. before mutant phage was harvested by PEG precipitation. The mutant phage were selected on a 1 ml NIP (4-hydroxy-3-iodo-5nitrophenylacetic acid)-BSA-Sepharose affinity column (prepared according to the manufacturers instructions) prewashed with 200 ml of PBS and blocked by 20 ml MPBS. Phage were loaded on the column in 10 ml MPBS and unbound material reapplied to ensure complete binding. The column was subsequently washed with 10 ml of MPBS and 500 ml of PBS. Phage bound to the affinity matrix was eluted with 5 column volumes of 0.33 mM NIP-Cap (example 48).
- Phage eluate was incubated for 30 min to 1 h with log phase (2×108 cells/ml) E. coli mutator strains without antibiotic selection. The infected cells were then diluted 1:100 in 2×TY and grown for 24h with antibiotic selection (15 μg/ml tetracycline or 30 μg/ml kanamycin for fdCAT2scFvB18 or fdDOGKanscFvB18 respectively). Phage from this culture was used for another round of affinity selection and mutation.
- Binding of phage antibodies was assayed by ELISA as in example 9 except that ELISA plates were coated with NIP-BSA (4-hydroxy-3-iodo-5-nitrophenylacetyl-BSA; 0.4 mg/ml). Culture supernatants were prepared following growth in Cellwells as described in example 21 and 20 μl of culture supernatant was added to each well diluted to 200 μl with MPBS.
- Phage samples giving signals in ELISA of more than twice the background were tested ELISA as above for non-specific binding against lysozyme, BSA or Ox-BSA (example 9). Specificity for NIP was further confirmed by an ELISA in which serial dilutions of NIP-CAP were added together with phage antibodies. Addition of increasing concentrations of NIP-CAP reduced the ELISA signal to the background level.
- Phage giving positive signals in ELISA were sequenced and 2 different mutants were subcloned into pHEN1 phagemid and transformed into HB2151 for soluble expression and TG1 for phage display (example 27).
- For expression of soluble scFv fragments, transformants in E. coli HB2151 were grown at 37° C. in 1
litre 2×TY, 0.2% glucose, 0.1 mg/ml ampicillin to an OD600 of 1 and expression of soluble scFv fragments induced by adding IPTG to 1 mM. Cultures were shaken at 30° C. for 16 h. - Soluble scFvB18 was concentrated from crude bacterial supernatant in a FLOWGEN ultrafiltration unit to a volume of 200 ml.
- The concentrate was passed two times over a 2 ml column of NIP-BSA-Sepharose prewashed with 200 ml of PBS. The column was washed with 500 ml of PBS and 200 ml of 0.1M Tris pH7.5, 0.5M NaC1 and phage antibodies eluted with 50 mM Citrate buffer pH2.3. The eluate was immediately neutralised with 1 MTris pH8. The eluate was dialysed against two changes of 1 litre PBS, 0.2 mM EDTA, Precipitated protein was removed by centrifugation at 10000 g and protein yield was determined by measuring the absorbance at 280 nm of the supernatant.
- After 4 rounds of mutation and selection, isolated clones were screened and in one or two rare examples strongly positive ELISA signals were obtained from phage antibodies derived from the mutation of each of fdCAT2scFvB18 and fdDOGKanscFvB18 in the ELISA. The ELISA conditions were such that the parent phage fdCAT2scFvB18 only generated weak signals. These phage antibodies giving strongly positive ELISA signals were enriched in further rounds by a factor of roughly 2.5 per round. Forty phage antibodies giving strongly positive signals were sequenced and they each displayed single mutations in six different positions in the scFvB18 nucleotide sequences, five of which reside in the light chain. More than 70% of the mutations occurred at positions 724 and 725 changing the first glycine in the J segment of the light chain (framework 4) to serine (in 21 cases) or aspartate (in 3 cases). The mutations found are shown in Table 9. The sequence of scFvB18 is shown in
FIG. 44A through 44B . - The nucleotide sequences encoding the scFv fragments of a framework mutant with the above glycine to serine mutation, as well as a mutant where Tyr in the CDR3 of the light chain had been mutated to aspartate, were amplified by PCR from the phage antibody clones and subcloned into pHEN1 phagemid (essentially as in example 25). This avoids possible problems with geneIII mutations caused by the mutator strains. The same pattern of ELISA signals was seen when the mutants were displayed on phage following rescue of the phagemid with helper phage (as described in example 25) as when the mutants were assayed when expressed from the phage genome as above.
- The scFv fragments from scFvB18 and the scFv fragments containing the glycine to serine and tyrosine to aspartate mutations respectively were expressed in solution (following transformation into E. coli HB2151 as in example 27) at 30° C. They showed no differences in the ELISA signals between wild-type B18 and the framework mutant. The signal obtained from the phage antibody with the Tyr mutated to aspartate in CDR3 of scFvB18 was about 10× stronger. Expression yields were found to be comparable as judged by Western blotting using an antiserum raised against g3p (as described above). Affinity measurements were performed using fluorescence quenching as described in example 23. Affinity measurement of affinity purified scFv fragments however showed scFvB18, and the scFvB18 (Gly->Ser) and scFvB18(Tyr->Asp) mutants all to have a comparable affinity of 20 nM for NIP-CAP.
- A Western blot using an anti-geneIII antibody showed the framework mutant had suffered significantly less proteolytic cleavage than scFvB18.
- Hence, the use of mutator strains generates a diverse range of mutants in phage antibodies when they are used as hosts for clones for gene III fusions. in this case some of the clones exhibit higher ELISA signals probably due to increased stability to proteolyic attack. The mutator strains can therefore be used to introduce diversity into a clone or population of clones. This diversity should generate clones with desirable characteristics such as a higher affinity or specificity. Such clones may then be selected following display of the proteins on phage.
- Expression of a Fv Fragment on the Surface of Bacteriophage by Non-Covalent Association of VH and VL Domains
- This example shows that functional Fv fragments can be expressed on the surface of bacteriophage by non-covalent association of VH and VL domains. One chain is expressed as a gene III fusion and the other as a soluble polypeptide. Thus Fv fragments can be used for all the strategies discussed for Fab fragments including dual combinatorial libraries (example 26).
- A useful genetic selection system for stably associated Fv fragments could be established if the expression of Fv fragments as fusion proteins on the phage surface would be possible such that one V domain is fused to the gene III protein and the other V domain is expressed separately in secreted form, allowing it to associate with the V domain on the fusion protein provided the interaction strength is sufficiently high. This idea was tested in a model experiment using the V domains from the anti-hen egg lysozyme antibody D1.3 by fusing the D1.3 VK gene to gene III and separately expressing the D1.3 VH domain.
- Experimentally this was achieved as follows: The vector fd-DOG1 was digested with the restriction enzymes PstI and Xho1. From the Fv expression plasmid pSW1-VHD1.3-
VKD1.3myc version 3/pUC119 (Ward, et al., 1989 supra) aPst 1/Xho I-digested restriction fragment was isolated that carries the VH domain coding sequence (terminated by 2 stop codons), a spacer region between VH and VK genes including a ribosome-binding site for expression of the VK gene, a pelB leader sequence, and, following in frame, the VK gene. This fragment was cloned into the digested fd-DOG vector to generate the construct fd-tet Fv D1.3. As shown on the map inFIG. 45 , the dicistronic VH/VK-gene III operon is transcribed from the gene III promoter; secretion of the VH domain is achieved by the gene III protein leader, secretion of the VK-geneIII fusion protein by the pelB leader sequence. For control purposes a second construct with the name fd-tet Fv D1.3 (ΔS-Stuffer) was made by a similar route as described above: the VH used in this construct carries an insertion of a 200 bp fragment in the Sty I restriction site at the junction ofVH CDR 3/FR4, thus interrupting the VH with several in frame stop codons. It is known from previous work that this insertion sufficiently disrupts the VH structure to abolish binding to the antigen lysozyme when expressed either as a soluble Fv or single-chain Fv fragment or as a single-chain Fv fragment on phage surface. This construct was used as a control. TG1 bacteria carrying either the fd-tet Fv D1.3, fd-tet Fv D1.3 (ΔS-Stuffer) or as single-chain wild-type control fd-tet scFv D1.3 plasmids were grown in liquid culture (medium 2×TY containing 15 μg/ml tetracycline) for 24 h to produce phage particles in the supernatant. After removal of bacterial cells by centrifugation the phage titer in the supernatants was determined by re-infecting exponentially growing TG1 cells with dilutions of the supernatants and scoring tetracycline-resistants colonies after plating on tetracycline-plates. The infectious phage titers achieved were 1×1011 tetR transducing units/ml for the single-chain wild-type control fd-tet scFv D1.3 and 2×1010 tetR transducing units/ml for Fv phage constructs fd-tet Fv D1.3 and fd-tet Fv D1.3 (ΔS-Stuffer). - The results are shown in
FIG. 46 . Phage derived from bacteria carrying and expressing the Fv construct fd-tet Fv D1.3 bind to the immobilised hen egg lysozyme, and when taking the phage titer into account, indeed apparently better than the single-chain Fv bearing phages produced by fd-tet scFv D1.3 carrying bacteria. The specificity of the reaction and the requirement for a functional VH domain is demonstrated by the fd-tet Fv D1.3 (ΔS-Stuffer) control in which disruption of the VH domain and consequently of the Fv fragment association eliminates binding to lysozyme. - As a final control of the expected structure of the VK/geneIII fusion protein a Western Blot was carried out. 20 μl of phage suspensions concentrated 100 fold by two sequential precipitations with PEG were applied to a 10% SDS-PAGE gel, electrophoretically separated and then transferred to a PVDF membrane (Immobilon, Millipore) in a semi-dry Western transfer apparatus (Hoefer). Remaining binding sites on the filter were blocked by 1 h incubation with 3% BSA in PBS, and detection of the gene III protein accomplished by incubation with a 1:1000 diluted rabbit anti-gene III antiserum for 2h, several washes in PBS/0.1
% Tween 20, incubation with peroxidase-conjugated goat anti-rat immunoglobulin antibodies, washes and development with the chromogenic substrate diaminobenzidine/COCl2/0.03% H2O2. The Fv phage fd-tet Fv D1.3 yields a band for the gene III fusion protein (data not shown), that is intermediate in size between the bands obtained for a wild-type gene III protein from fd-DOG1 and the scFv-gene III fusion protein from fd-tet scFv D1.3, thus proving the presence of a single immunoglobulin domain covalently fused to the gene III product in the Fv phage. - In summary, Fv-gene III fusions in which one V domain is fused to the gene III protein and the other V domain associates non-covalently can be presented in functionally active form on the surface of filamentous phage. This opens the possibility to genetically select for stably associated Fv fragments with defined binding specificities from V gene libraries expressed in phages.
- A PCR Based Technique for One Step Cloning of Human V-Genes as Fab Constructs
- This example describes a PCR based technique to “assemble” human Fabs by splicing together the heavy and light chain DNA with a separate piece of ‘linker’ DNA. A mixture of universal primers is used which should make the technique applicable to all human V-genes.
- The general technique for PCR assembly of human V-genes to create a Fab construct is described. The efficiency of this technique was assessed by “assembling”, cloning and expressing a human anti rhesus-D (Rh-D) Fab from a IgG-K monoclonal hybridoma. We also demonstrate the potential to rescue human monoclonal antibodies from polyclonal cell populations by assembling, cloning, expressing and isolating an IgG-lambda monoclonal anti-Rh-D Fab from a polyclonal lymphoblastic cell line (LCL).
- The overall strategy for the PCR assembly is shown in
FIG. 47 and is described in more detail below. For Fab assembly, the VH-CH1 and VK-CK or V lambda-C lambda light chains are amplified from first strand cDNA and gel purified. Heavy and light chain DNA are then combined together with linker DNA and flanking oligonucleotides in a new PCR reaction. This results in a full length Fab construct since the 5′ end of the linker DNA is complementary to the 31 end of the CH1 domain and the 3′ end of the linker is complementary to the 5′ end of the light chain domain. The linker DNA contains terminal residues of the human CH1 domain, the bacterial leader sequence (pelB) for the light chain and the initial residues of the VK or V lambda light chain. Finally, after gel purification, the Fab construct is reamplified with flanking oligonucleotides containing restriction sites for cloning. - Oligonucleotide Primers:
- In order to develop the PCR cloning of human V genes it was necessary to design a new range of human specific oligonucleotide primers.
- The PCR primers at the 51 end of the VH and VK and Vlambda gene exon (BACK primers) are based on sequence data extracted from the Kabat database, (Kabat, E. A. et al, Sequences of Proteins of Immunological Interest. 4th Edition. US Department of Health and Human Services. 1987) the EMBL database, the literature (Chuchana, P., et al, Eur J. Immunol., 1990. 20:1317) and unpublished data. The sequence of the VH, VK and Vlambda primers are given in table 1. In addition, extended VH primers with SfiI sites at the 5′ end were also designed (Table 10) for adding a restriction site after assembly.
- Table 10 also shows the 3′ primers (FORWARD primers) designed for the PCR based cloning of human V genes. There are two sets of these depending on whether a Fab or scFv is to be produced. For Fab assembly, the forward primer was based at the 3′ end of the CH1 domain, CK domain and Clambda domain. In addition, the CK and C2 FORWARD primers were also synthesized as extended versions with Not1 sites at their 5′ ends.
- Primers complementary to the CH1 forward primers and the VkK and V lambda back primers were synthesized to permit generation of linker DNA by PCR amplification of a plasmid template containing the Fab linker (Table 10). To ensure adequate amplification, the primers were extended into the actual linker sequence.
- A RNA Preparation
- This is essentially the same as described in Example 14, but using material of human origin. In the results given in this example human hybridoma and human polyclonal lymphoblastic cell lines were used.
- B cDNA Preparation
- Approximately 4 μg of total RNA in 20 ul water was heated at 65° C. for 3 minutes, quenched on ice and added to a 30 ul reaction mixture resulting in a 50 ul reaction mixture containing 140 mM KC1, 50 mM Tris, HC1 (pH8.1 @ 42° C.), 8 mM MgCl2, 10 mM DTT, 500
uM deoxythymidine triphosphate 500 uM deoxycytosine triphosphate, 500 uM deoxyadenosine triphosphate and 500 uM deoxyguanosine triphosphate, 80 units of human placental RNAse inhibitor and 10 pmol of the appropriate Forward primer (HulgG1-4CH1FOR, HuIgMFOR, HuCKFOR, HuCLFOR). Two ul (50 units) of avian myeloblastosis virus (AMV) reverse transcriptase was added, the reaction incubated at 42° C. for 1 hour, heated to 100° C. for 3 minutes, quenched on ice and centrifuged for 5 minutes. - C Primary PCRs
- For the primary PCR amplifications, an equimolar mixture of the appropriate family based BACK and FORWARD primers was used. (See specific examples 40A and 40B given later in this example). A 50 ul reaction mixture was prepared containing 5 ul of the supernatant from the cDNA synthesis, 20 pmol total concentration of the FORWARD primers, 250 uM dNTPs, 50 mM KC1, 100 mM Tris. HC1 (pH 8.3), 1.5 mM MgCl2, 175 ug/ml BSA and 1 ul (5 units) Thermus aquaticus (Taq) DNA polymerase (Cetus, Emeryville, Calif.). The reaction mixture was overlaid with paraffin oil and subjected to 30 cycles of amplification using a Techne thermal cycler. The cycle was 94° C. for 1 minute (denaturation), 57° C. for 1 minute (annealing) and 72° C. for 1 minute (extension). The product was analyzed by running 5 ul on a 2% agarose gel. The remainder was extracted twice with ether, twice with phenol/chloroform, ethanol precipitated and resuspended in 50 ul of H2O.
- D Preparation of Linker
- To make the Fab linker DNA, 13 separate PCR reactions were performed using HulgG1-4CH1FOR and each of the reverse VK or V lambda oligonucleotides. The template was approximately 1 ng of pJM-1Fab D1.3 (
FIG. 48 ) The PCR reaction reagents were as described above and the cycle was 94° C.:1 min, 45° C.:1 min and 72° C.:1 min. The linkers were analyzed on a 4% agarose gel, purified on a 2% agarose gel, eluted from the gel on a Spin-X column and ethanol precipitated. - E Assembly PCRs
- For PCR assembly of a human Fab approximately 1 ug of a primary heavy chain amplification and 1 ug of a primary light chain amplification were mixed with approximately 250 ng of the appropriate linker DNA in a PCR reaction mixture without primers and cycled 7 times (94° C.: 2 min, 72° C., 2.5 min) to join the fragments. The reaction mixture was then amplified for 25 cycles (94° C.:1 ml, 68° C.-72° C.:1 min, 72° C., 2.5 min) after the addition of 20 pmol of the appropriate flanking BACK and FORWARD primers.
- F Adding Restriction Sites
- The assembled products were gel purified and reamplified for 25 cycles (94° C.:1 min, 550C:1 min, 72° C.:25 min) with the flanking oligonucleotides containing the appended restriction sites. PCR buffers and NTPs were as described previously.
- a. PCR assembly of a Fab from a human hybridoma: the human monoclonal anti Rh-D cell lines Fog-1 (IgG-k) was derived from EBV transformation of the PBLs of a Rh-D negative blood donor immunized with Rh-D positive blood and has been previously described (Melamed, M. D., et al., J. Immunological Methods 1987. 104:245) (Hughes-Jones N. C., et al., Biochem. J. 1990. 268:135) (Gorick, B. D. et al., Vox. Sang. 1988. 55:165) Total RNA was prepared from approximately 107 hybridoma cells. First strand cDNA synthesis was performed as described above using the primers HulgG1-4CH1FOR and HuCKFOR. Primary PCRs were performed for the VH-CH1 using a mixture of the 6 HuVHBACK primers and HuIgG1-4CG1FOR and for the VK-CK using a mixture of the 6 HuVKBACK primers and HuCKFOR. A Fab construct was assembled as described above, restricted with SfiI and NotI, gel purified and ligated into pJM-1Fab D1.3 restricted with SfiI and NotI. The ligation mixture was used to transform competent E. coli E.M.G. cells. Ninety-six clones were toothpicked into media in microtitre plate wells, grown to mid-log phase at 30° C. and then expression of the Fab was induced by heat shocking at 42° C. for 30 min followed by growing for 4 hours at 37° C. The ninety-six clones were then screened for anti-Rh-D activity as described below.
- b. assembly of human Fabs from a polyclonal (LOL) A polyclonal LCL “OG” was derived from EBV transformation of approximately 107 peripheral blood lymphocytes (PBLs) from a Rh-D negative donor immunized with Rh-D positive red blood cells. The cells were plated at a concentration of approximately 105 cells per well. Positive wells were identified by screening the cells harvested and then subcloned once. Typing of the well indicated that an IgG-lambda antibody was being produced. At this stage, total RNA was prepared from approximately 106 cells. First strand cDNA synthesis was performed as described above using the primers HulgG1-4CG1FOR and HuCLFOR. Primary PCRs were performed for the VH-CH1 using a mixture of the 6 HuVHBACK2 primers and HulgG1-4 CG1FOR and for the V lambda-C lambda using a mixture of the 7 HuV BACK primers and HuC FOR. Restriction, cloning and screening proceeded as described. To determine the diversity of the clones, the VH and V lambda genes of 15 clones were PCR amplified, restricted with the frequent cutting restriction enzyme BstN1 and analyzed on a 4% agarose gel (see example 20).
- Assay for anti-Rh-D activity and demonstration of specificity: A 5% (vol/vol) suspension of either Rh-D positive (OR2R2) or Rh-D negative (Orr) erythrocytes in phosphate buffered saline (PBS, pH 7.3) were incubated with a papain solution for 10 min at 37° C. The erythrocytes were washed three times in PBS and a 1% (vol/vol) suspension of erythrocytes was made up in PBS supplemented with 1% (vol/vol) of bovine serum albumin (BSA). Fifty ul of a papain treated erythrocyte suspension and Soul of phage supernatant were placed in the wells of round bottom microtitre plates and the plates were placed on a T/Itertek plate shaker for 2 min. After 15 min incubation at 37° C. 100 ul of PBS/BSA was added to each well. The plates were centrifuged at 200 g for 1 min and the supernatant was discarded. The erythrocytes were resuspended in the remaining PBS/BSA and the Fab fragments were crosslinked by addition of the 9E10 monoclonal antibody (Soul a 1 ug/ml solution in PBS/BSA) directed against the myc peptide tag (Ward, E. S., et al., Nature 1989. supra). The plates were placed at room temperature (RT) until sedimentation had occurred. Agglutination of erthrocytes caused a diffuse button of erythrocytes and the results were evaluated macroscopically. Specificity was confirmed with a standard prepapainized (as above) panel of 9 erythrocyte suspensions in PBS (all suspensions blood group O, 4 D positive and 5 D negative) known to have homozygous expression of all the clinically relevant erythrocyte blood group alloantigens. The number of copies of the D antigen on the D positive cells varied between 10,000 and 20,000 per erythrocyte depending on the Rh genotype. Briefly, 50 ul phage supernatant in PBS supplemented with 2% (vol/vol) skimmed milk was mixed with 50 ul of a 2% erythrocyte suspension in PBS in glass tubes and incubated for 15 min at 37° C. After one wash with PBS/BSA the erythrocytes were pelleted and resuspended in 50 ul donkey anti-human lambda light chain (Sigma L9527, diluted 1:40 in PBS/BSA). The tubes were centrifuged for 1 min at 200 g and agglutination was read macroscopically using “tip and roll” method.
- Results
- a PCR assembly of a Fab from a human hybridoma: A single band of the correct size was obtained after amplification. Thirty-eight of 96 clones (40%) screened specifically agglutinated Rh-D positive but not Rh-D negative red blood cells. The results demonstrate a high frequency of successful splicing in the assembly process and the potential of this technique for one step cloning of human hybridomas.
- b Assembly of human Fabs from a polyclonal lymphoblastic cell line (LCL): Analysis of the diversity of the clones indicated that 3 different heavy chain families and 2 different light chains families were present. Five anti-Rh-D specific clones were identified out of 96 screened. The VH and Vλ chains had identical nucleotide sequences in each clone and were typical of anti-Rh-D V-genes (unpublished results). The results demonstrate the potential of this technique to assemble, clone and isolate human antibody fragments from polyclonal cell populations (see also section on isolation of specific binding activities from an ‘unimmunized’ human library (examples 42 and 43).
- Selection of Phage Displaying a Human Fab Fragment Directed Against the Rhesus-D Antigen by Binding to Cells Displaying the Rhesus D Antigen on their Surface
- A large number of important antigens are integral components of cell surface membranes, i.e. they are cell surface antigens. These include tumor specific antigens and red and white blood cell surface antigens. In many instances, it would be important to isolate antibodies against these antigens. For example, antibodies directed against the rhesus-D (Rh-D) antigen on red blood cells are used both diagnostically and therapeutically. Many of these antigens are difficult to purify and some, like Rh-D, are not biologically active when isolated from the membrane. Thus, it would be useful to be able to affinity purify antibody fragments displayed on the surface of bacteriophage directly on cell surface antigens. To test the feasibility of affinity purification on cell surface antigens, the anti-Rh-D human monoclonal antibody Fog-B was displayed as a Fab fragment on the surface of bacteriophage fd. The displayed Fog-B Fab fragment bound antigen as determined by agglutination assay and could be affinity purified on the basis of its binding on the surface of Rh-D positive red blood cells but not Rh-D negative red blood cells.
- Materials and Methods
- Construction of a clone encoding an anti-Rh-D Fab fragment in phagemid pHENI and display of the Fab fragment on the surface of bacteriophage fd.
- The human hybridoma Fog-B has been previously described (N.C. Hughes-Jones et al, Biochem, J., 268 135 (1990). It produces an IgG-1/lambda antibody which binds the Rh-D antigen. RNA was prepared from 107 hybridoma cells using a modified method of Cathala (as described in example 14) and 1st strand cDNA synthesized using specific immunoglobulin heavy and light chain primers (HuVH1FOR and HuCλ FOR (5′-GGA ATT CTT ATG AAG ATT CTG TAG GGG CCA C-3′) (SEQ ID NO:73)) as described in example 14. The VH gene was subsequently amplified from an aliquot of the 1st strand cDNA using HuVH4aBACK and HuVH1FOR. The Vλ gene was amplified using a Vλ primer specific for Fog-B (VλFog-B: 5′-AAC CAG CCA TGG CC AGT CTG TGT TGA CGC AGC C-3′) (SEQ ID NO:74). The PCR conditions were as described in example 40. The PCR products were analyzed by running 5 μl on a 2% agarose gel. The remainder was extracted twice with ether, twice with phenol/chloroform, ethanol precipitated and resuspended in 50 μl of H2O. The amplified VH DNA was digested with Pst1 and BstEII, and the amplified Vλ-Cλ DNA with Ncol and EcoR1. The fragments were purified on a 2% agarose gel, extracted using GENECLEAN, and sequentially ligated into the soluble expression vector pJM-1 Fab D1.3 (
FIG. 48A ). Clones containing the correct insert were initially identified by restriction analysis and verified by assay of expressed soluble Fab (see example 23 for induction conditions). The Fog-B Fab cassette was amplified from pJM-1 by PCR using HuVH4BACK-Sfi and Hu Cλ-Not, digested with the appropriate restriction enzymes and ligated into pHEN1. Clones containing the correct insert were identified initially by restriction analysis and subsequently by assay (see example 25 for induction conditions). - Assay for soluble Fog-B Fab fragment and phage displayed Fog-B Fab fragment for anti-Rh-D activity and documentation of specificity.
- Assay of the soluble expressed Fab was performed on unconcentrated E. coli supernatant. Assay of Fog-B displayed on the phage surface was performed on phage that had been concentrated 10 fold by PEG precipitation and then resuspended in PBS. The assays for activity and specificity are as described in example.
- Cell Surface Affinity Purification of Phage Displaying Fog-B Anti-Rh-D Fab Fragment
- Purified Fog-B phage was mixed with purified phage Fd-Tet CAT-1 displaying the anti-lysozyme scFv D1.3 (pAbD1.3) in a ratio of approximately 1 Fog-B:50 scFvD1.3. Prepapainized erythrocytes (OR2R2 [Rhesus positive] or Orr [Rhesus negative]) were suspended in PBS supplemented with 2% skimmed milk powder in a concentration of 4×107/ml. One ml of this suspension was mixed with 1011 phage suspended in 2 ml of PBS supplemented with 2% skimmed milk and incubated for 30 min at room temperature under continuous rotation. The erythrocytes were washed three times with an excess of ice-cold PBS (10 ml per wash) and subsequently pelleted. The phage were eluted from the cells by resuspending in 200 μl of 76 mM citric acid pH 2.8 in PBS for 1 min. The cells were then pelleted by centrifugation for 1 min at 3000 rpm and the supernatant containing the eluted phage was neutralized by adding 200 μl of 240 mM Tris-base, 22 mM Disodium hydrogen phosphate in 1% w/vol albumin. Serial dilutions of the eluate was used to infect TG1 cells. Fog-B Fab phage were selected on ampicillin plates and scFvD1.3 phage on tetracycline plates and the titre of each determined prior to selection, after selection on rhesus-D negative cells and after selection on rhesus-D positive cells.
- Results
- Fog-B Fab fragment displayed on the surface of the phage derived from the phagemid PHEN clone specifically agglutinated rhesus-D positive but not rhesus D-negative red blood cells. Affinity purification of the Fog-1 Fab phagemid on Rh-D positive red blood cells resulted in an enrichment from 1:50 to 1500:1 (Fog-B Fab:scFvD1.3), whereas purification on Rh-D negative red blood cells demonstrated essentially no enrichment (10 fold).
TITRE RATIO Fog-B Fab scFvD1.3 Fog-B FAb/scFvD1.3 Prior to selection 1.0 × 108 5.0 × 109 1:50 Selection on Rh-D 2.0 × 104 1.0 × 105 1:5 negative cells Selection on Rh-D 6.0 × 106 4.0 × 103 1500:1 positive cells - A PCR Based Technique for One Step Cloning of Human scFv Constructs
- Assembly of human scFv is similar to the assembly of mouse scFvs described in example 14. To develop the PCR cloning of human V genes it was necessary to design a new range of human specific oligonucleotide primers (table 10).
- The use of these primers for the generation of human Fabs is described in example 40. The assembly of human scFvs is essentially the same but requires a set of FORWARD primers complementary to the J segments of the VH, VK and V lambda genes. (For Fabs FORWARD primers complementary to the constant region are used). The J segment specific primers were designed based on the published JH, JK and J lambda sequences (Kabat, E. A. et al, Sequences of Proteins of Immunological Interest, 4th Edition, US Department of Health and Human Services. 1987).
- In addition, a different linker is needed for scFvs than for Fabs so for human scFvs a new set of primers was needed to prepare the linker. Primers complementary to the JH forward primers and the VK and V lambda back primers were synthesized to permit generation of linker DNA by PCR amplification of a plasmid template containing the scFv linker (Table 10,
FIG. 49 ). To ensure adequate amplification, the primers were extended into the actual linker sequence. Using these primers to make the scFv linker DNA, 52 separate PCR reactions were performed using each of the 4 reverse JH primers in combination with each of the 13 reverse VK and V lambda oligonucleotides. The template was approximately 1 ng of pSW2scD1.3 (Ward, E. S. 1989 supra) containing the short peptide (Gly4Ser)3 (Huston, J. S. et al., Gene 1989. 77:61) - This example describes the generation of a human library of scFvs made from an unimmunized human:
- 500 ml of blood, containing approximately 108 B-cells, was obtained from a healthy volunteer blood donor. The white cells were separated on Ficoll and RNA was prepared as described in example 14.
- Twenty percent of the RNA, containing the genetic material from approximately 2×107 B-cells, was used for cDNA preparation as described in example 40. Heavy chains originating from IgG and IgM antibodies were kept separate by priming cDNA synthesis with either an IgG specific primer (HuIgG1-4CH1FOR) or an IgM specific primer (HuIgMFOR). Aliquots of the cDNA was used to generate four separate scFv libraries (IgG-K, IgG-lambda, IgM-K and IgM-lambda) as described in example 40. The resulting libraries were purified on 1.5 agarose, electroeluted and ethanol precipitated. For subsequent cloning, the K and lambda libraries were combined giving separate IgG and IgM libraries.
- Cloning of the library: The purified scFv fragments (1-4 ug) were digested with the restriction enzymes NotI and either Sfil or NcoI. After digestion, the fragments were extracted with phenol/chloroform, ethanol precipitated. The digested fragments were ligated into either SfiI-NotI or NcoI-NotI digested, agarose gel electrophoresis purified pHEN1 DNA (6 ug) (see example 24), in a 100 μl ligation mix with 2,000 U T4 DNA ligase (New England Biolabs) overnight at room temperature. The ligation mix was purified by phenol extraction and ethanol precipitated. The ligated DNA was resuspended in 10 μl of water, and 2.5 μl samples were electroporated into E. coli TG1 (50 μl). Cells were grown in 1 ml SOC for 1 hr and then plated on 2×TY medium with 100 μg/ml ampicillin and 1% glucose (AMP-GLU), in 243×243 mm dishes (Nunc). After overnight growth colonies were scraped off the plates into 10
ml 2×TY containing AMP-GLU and 15% glycerol for storage at −70° C. as a library stock. - Cloning into SfiI-NotI and NcoI-NotI digested pHEN1 yielded libraries of 107 and 2×107 clones respectively for the IgM libraries and approximately 5×107 clones for each of the two IgG libraries.
- Isolation of Binding Activities from a Library of scFvs from an Unimmunized Human
- The ability to select binding activities from human antibody libraries displayed on the surface of phage should prove even more important than isolation of binding activities from murine libraries. This is because the standard way of generating antibodies via hybridoma technology has not had the success with human antibodies that has been achieved with mouse. While in some instances it will be possible to make libraries from immunized humans, in many cases, it will not prove possible to immunize due to toxicity or lack of availability of an appropriate immunogen or ethical considerations. Alternatively, binding activities could be isolated from libraries made from individuals with diseases in which therapeutic antibodies are generated by the immune response. However, in many cases, the antibody producing cells will be located in the spleen and not available in the circulating pool of peripheral blood lymphocytes (the most easily accessible material for generating the library). In addition, in diseases associated with immunosuppression, therapeutic antibodies may not be produced.
- An alternative approach would be to isolate binding activities from a library made from an unimmunized individual. This approach is based on estimates that a primary repertoire of 107 different antibodies is likely to recognize over 99% of epitopes with an affinity constant of 105 M−1 or better. (Pewrelson, A. S. Immunol. Rev, (1989) 110:5). While this may not produce high affinity antibodies, affinity could be boosted by mutation of the V-genes and/or by using the isolated VH domain in a hierarchical approach with a library of light chains (or vice versa). In this section, we demonstrate the feasibility of this approach by isolating specific antigen binding activities against three different antigens from a library of scFvs from an unimmunized human.
- Materials and Methods
- The generation of the human scFv library used for the isolation of binding activities described in this example is detailed in example 42.
- Estimation of Diversity of Original and Selected Libraries:
- Recombinant clones were screened before and after selection by PCR (example 20) with primers LMB3 (which sits 5′ of the pelB leader sequence and is identical to the reverse sequencing primer (−40 n) of pUC19) and fd-SEQ1 (see example 37) followed by digestion with the frequent-cutting enzyme BstN1. Analysis of 48 clones from each unselected library indicated that 90% of the clones had inset, and the libraries appeared to be extremely diverse as judged by the BstNI restriction pattern.
- Rescue of Phagemid Libraries for Enrichment Experiments: To rescue phagemid particles from the library, 100
ml 2×TY containing AMP-GLU (see example 42) was inoculated with 109 bacteria taken from the library (prepared in example 42) (approx. 10 μl) and grown for 1.5 hr, shaking at 37° C. - Cells were spun down (IEC-centrifuge, 4 K, 15 min) and resuspended in 100 ml prewarmed (37° C.) 2×TY-AMP (see example 41) medium, 2×1010 pfu of VCS-M13 (Stratagene) particles added and incubated 30 min at 37° without shaking. Cells were then transferred to 900
ml 2×TY containing ampicillin (100 μg/ml) and kanamycin (25 μg/ml) (AMP-KAN), and grown overnight, while shaking at 37° C. Phage particles were purified and concentrated by three PEG-precipitations (see materials and methods) and resuspended in PBS to 1013 TU/ml (ampicillin resistant clones). - Enrichment for phOx:BSA binders by selection on tubes: For enrichment, a 75×12 mm Nunc-immunotube (Maxisorp; Cat. No. 4-44202) was coated with 4 ml phOx:BSA (1 mg/ml; 14 phOx per BSA in 50 mM NaHCO3 pH 9.6 buffer) overnight at room temperature. After washing three times with PBS, the tube was incubated for 2 hr at 37° C. with PBS containing 2% Marvel (2% MPBS) for blocking. Following three PBS washes, phagemid particles (1013 TU) in 4 ml of 2% MPBS were added, incubated 30 min at room temperature on a rotating turntable and left for a further 1.5 hours. Tubes were then washed with 20 washes of PBS, 0.1
% Tween ml 100 mM triethylamine pH 11.5 and rotating for 15 min. The eluted material was immediately neutralised by adding 0.5 ml 1.0 M Tris-HC1, pH 7.4 and vortexed. Phage was stored at 4° C. - Eluted phage (in 1.5 ml) was used to infect 8 ml logarithmic growing E. coli TG1 cells in 15-
ml 2×TY medium, and plated on AMP-GLU plates as above yielding on average 107 phage infected colonies. - For selection of phOx:BSA binders, the rescue-tube enrichment -plating cycle was repeated 4 times, after which phagemid clones were analysed for binding by ELISA.
- Enrichment for lysozyme binders by panning and on columns: A petri dish (35×10 mm Falcon 3001 Tissue culture dish) was used for enrichment by panning. During all steps, the plates were rocked on an A600 rocking plate (Raven Scientific). Plates were coated overnight with 1 ml turkey egg white lysozyme (3 mg/ml) in 50 mM sodium hydrogen carbonate (pH 9.6), washed three times with 2 ml PBS, and blocked with 2
ml 2% MPBS at room temperature for 2 hours. After three PBS washes approximately 1012 TU phage particles in 1ml 2% MPBS were added per plate, and left rocking for 2 hr at room temperature. Plates were washed for 5 min with 2 ml of the following solutions: 5 times PBS, PBS-Tween (0.02% Tween-20), 50 mM Tris-HC1 (pH 7.5)+500 mM NaC1, 50 mM Tris-HC1 (pH 8.5)+500 mM NaC1, 500 mM Tris-HC1 (pH 9.5)+500 mM NaC1 and finally 50 mM sodium hydrogen carbonate pH 9.6. Bound phage particles were then eluted by adding 1ml 100 mM triethylamine pH 11.5 and rocking for 5 min before neutralising with 1 M Tris-HC1 (pH 7.4) (as above). Alternatively, 1 ml turkey egg white lysozyme-Sepharose columns were used for affinity purification (McCafferty, J., et al., Nature, 1990, 348:552). Columns were washed extensively with PBS, blocked with 15ml 2% MPBS, and phage (1012 TU) in 1ml 2% MPBS loaded. After washing with 50 ml PBS, 10 ml PBS— Tween (PBS+0.02% Tween-20), 5 ml of 50 mM Tris-HC1 (pH 7.5)+500 mM NaC1, 5 mM Tris-HC1 9pH 8.5)+500 mM NaC1, 5 ml of 50 mM Tris-HC1 (pH 9.5)+500 mM NaC1 and finally 5 ml of 50 mM sodium hydrogen carbonate pH 9.6. Bound phage was eluted using 1.5ml 100 mM triethylamine and neutralised with 1 M Tris-HC1 (pH 7.4). - For selection of turkey egg white lysozyme binders, the rescue-tube enrichment-plating cycle or rescue-column-plating cycle was repeated 4 times, after which phagemid clones were analysed for binding by ELISA.
- Rescue of individual phagemid clones for ELISA: Clones resulting from reinfected and plated phage particles eluted after 4 rounds of enrichment, were inoculated into 150 μl of 2×TY-AMP-GLU in 96-well plates (cell wells, Nunclon), grown with shaking (250 rpm) overnight at 37° C. A 96-well plate replicator (‘plunger’) was used to inoculate approximately 4 μl of the overnight cultures on the master plate into 200 μl fresh 2×TY-AMP-GLU. After 1 hr, 50
μl 2×TY-AMP-GLU containing 108 pfu of VCS-M13 was added to each well, and the plate incubated at 37° C. for 45 min, followed by shaking the plate at 37° C. for 1 hr. Glucose was then removed by spinning down the cells (4K, 15 min), and aspirating the supernatant with a drawn out glass pasteur pipet. Cells were resuspended in 200μl 2×TY-AMP-KAN (Kanamycin 50 ug/ml) and grown 20 hr, shaking 37° C. Unconcentrated supernatant containing phage was taken for analysis by ELISA. - ELISA
- Analysis for binding to phOx:BSA, BSA or lysozyme was performed by ELISA (see example 9), with 100 μg/ml phOx:BSA or BSA, or 3 mg/ml turkey egg white lysozyme used for coating. Determination of cross reactivity to unrelated antigens with the isolated clones was also determined by ELISA on plates coated with 100 ug/ml of an irrelevant antigen (keyhole limpet haemocyanin (KLH), ovalbumin, chymotrypsinogen, cytochrome C, thyroglobulin, GAP-DH (glyceraldehyde-3-phosphate dehydrogenase), or trypsin inhibitor).
- Characterization of ELISA positive clones: All antigen specific clones isolated were checked for cross reactivity against a panel of irrelevant antigens as described above. The diversity of the clones was determined by PCR screening as described above and at least two clones from each restriction pattern were sequenced by the dideoxy chain termination method.
- Results
- Isolation and characterization of phOx:BSA binders: After 4 rounds of selection, ELISA-positive clones were isolated for phOx:BSA. All clones originated from the IgM library. Of 96 clones analysed, 43 clones were binding to both phOx:BSA and BSA, with ODs ranging from 0.4 to 1.3 (background 0.125). These clones are designated as BSA binders. The binding to BSA seemed to be specific, since none of the 11 clones analysed gave a signal above background when used in an ELISA with KLH, ovalbumin, chymotrypsinogen, cytochrome C, lysozyme, thyroglobulin, GAP-DH, or trypsin inhibitor. All BSA binding clones had the same BstNI restriction pattern, and 14 clones were completely sequenced. Thirteen of the fourteen clones had the same sequence, the VH was derived from a human VH3 family gene and the VL from a
human V lambda 3 family gene (Table 1). The other BSA binder was derived from a human VH4 family gene and a human Vk1 family gene (data not shown). - One clone was isolated which bound to phOx:BSA only (OD 0.3), and bound phage could be completed off completely by adding 0.02 mM 4-ε-amino-caproic acid methylene 2-phenyl-oxazol-5-one (phOx-CAP) as a competitor. Also no binding above background could be detected to the panel of irrelevant proteins described above. The sequence revealed a VH derived from a human VH1 family gene and a VL derived from a
human V lambda 1 family gene (Table 11). - Isolation and characterisation of lysozyme binders: After 4 rounds of selection, 50 ELISA-positive clones were isolated for turkey lysozyme. The majority of the clones, greater than 95%, were from the IgM library. The binding to lysozyme seemed to be specific, since none of the clones analysed gave a signal above background when used in an ELISA with KLH, ovalbumin, chymotrypsinogen, cytochrome C, thyroglobulin, GAP-DH, or trypsin inhibitor. The lysozyme binding clones gave 3 different BstNI restriction patterns, and at least 2 clones from each restriction pattern were completely sequenced. The sequences indicated the presence of 4 unique human VH-VL combinations. (Table 11).
- The results indicate that antigen binding activities can be isolated from repertoires of scFvs prepared from IgM cDNA from human volunteers that have not been specifically immunized.
- Rescue of human IgM Library Using Helper Phage Lacking Gene 3 (δg3)
- This example describes the rescue of
gene 3 fusions from a human library using a helper phage with agene 3 deletion. - 100 μl of bacterial stock of the IgM phagemid library prepared as described (example 42), containing 5×108 bacteria, was used to inoculate 100 mls of 2×TY medium containing 100 μg/ml ampicillin, 2% glucose (TY/Amp/Glu). This was grown at 37° C. for 2.5 hours. 10 mls of this culture was added to 90 mls of prewarmed TY/Amp/Glu and infection carried out by adding 10 mls of a 200 fold concentrate of K07 helper phage lacking gene 3 (M13KO7gIIIΔ No. 3) (example 34) and incubating for 1 hour at 37° C. without shaking. Preparation of M13KO7gIII No. 3 was as described in example 34. After centrifugation at 4,000 r.p.m. for 10 minutes the bacteria were resuspended in 100 mls of 2×TY medium containing 100 μg/ml ampicillin (with no glucose). Titration of the culture at this point revealed that there were 1.9×108 infected bacteria as judged by their ability to grow on plates containing both ampicillin (100 μg/ml) and kanamycin (50 μg/ml). Incubation was continued for 1 hour with shaking before transferring to 2.5 litres of 2×TY medium containing 100 μg/ml ampicillin, 50 μg/ml kanamycin, contained in five 2.5 litre flasks. This culture was incubated for 16 hours and the supernatant prepared by centrifugation. (10-15 minutes at 10,000 r.p.m. in a Sorvall RC5B centrifuge at 40C ). Phage particles were harvested by adding ⅕th volume of 20% polyethylene glycol, 2.5 M NaC1, standing at 40C for 30 minutes and centrifuging as above. The resulting pellet was resuspended in 40 mls of 10 mM Tris, 0.1 mM EDTA pH 7.4 and bacterial debris removed by centrifugation as above. The packaged phagemid preparation was then re-precipitated, collected as above and resuspended in 10 mls of 10 mM Tris, 0.1 mM EDTA pH 7.4. The litre of this preparation was 4.1×1013 transducing units/ml (ampicillin resistance).
- Tubes coated with OX-BSA were prepared as described in example 45 for panning the phagemid library from example 42. The rescued library was also panned against tubes coated with bovine thyroglobulin (Sigma). These were coated at a concentration of 1 mg/ml thyroglobulin in 50 mM NaHCO3 pH9.6 at 37° C., overnight. Tubes were blocked with PBS containing 2% milk powder (PBS/M) and incubated with 1 ml of the rescued phagemid library (the equivalent of 250 mls of culture supernatant) mixed with 3 mls of PBS/M for 3 hours. Washing, elution, neutralisation and infection were as described in example 45.
- Results: Panning Against Oxazalone—BSA
- The first round of panning against OX-BSA yielded 2.8×106 phage. A large bacterial plate with 1.4×106 colonies derived from this eluate was scraped into 10 mls of 2××TY, 20% glycerol, shaken for 10 minutes, aliquoted and stored. This was also used to inoculate a fresh culture for rescue with M13KO7gIII No. 3. (Bacteria and rescued phage derived from first round panning against OX-BSA are named OXPAN1. Bacteria or rescued phage derived from second and third round pannings are named OXPAN2 and OXPAN3 respectively) Rescue of phagemid with M13KO7gIII No. 3 after each round of panning was essentially as described above but using 5 ml volumes for the initial cultures in TY/Amp/Glu, using 1 ml of helper phage and transferring to 100-500 mls of 2×TY medium containing 100 μg/ml ampicillin, 50 μg/ml kanamycin. Second and third round panning steps were as described above for the first round, but using 0.8-11.0 mls of 100 fold concentrated phage (the equivalent of 80-100 mls of culture supernatant). The eluate from the second round panning contained 8×108 infectious particles and the eluate from the third round panning contained 3.3×109 infectious particles.
- Panning Against Thyroglobulin
- The first round panning against thyroglobulin yielded 2.52×105 infectious particles. Half of the eluate was used to generate 1.26×105 bacterial colonies on a large plate. These colonies were scraped into 10 mls of 2×TY, 20% glycerol, shaken for 10 minutes, aliquoted and stored. These bacteria and rescued phage derived from them are termed THYPAN1, and used to inoculate a fresh culture for rescue with M13KO7gIII No. 3 to give a polyclonal rescued phage preparation. Material similarly derived from second and third round pannings are termed THYPAN2 and THYPAN3 respectively. Second and their round pannings with thyroglobulin were as described for second and third round OX-BSA panning. The eluate from the second round panning contained 8×107 transducing units and the eluate from the third round panning contained 6×107 infectious particles.
- ELISA Screening of Clones Derived by Panning
- 40 colonies derived form the third round of panning against thyroglobulin (THYPAN3) were picked into a 96 well plate and grown overnight at 37° C. in 200 μl of TY/Amp/clu. Similarly 48 colonies from two rounds and 48 colonies from three rounds of panning against OX-BSA were grown (OX-PAN2 and OX-PAN3). Polyclonal phage were prepared at the same time.
Next day 5 μl from each culture was transferred to 100 μl of fresh prewarmed TY/Amp/Glu grown for 1.5 hours and M13KO7gIII No. 3 added (2×105 infectious phage per well in 100 μl of TY/Amp/Glu). These were incubated for 1 hour at 37° C. without shaking, centrifuged at 4,000 r.p.m. for 10 minutes, resuspended in 150 μl of 2×TY medium containing 100 μg/ml ampicillin and incubated for a further hour with shaking before adding to 2mls of medium containing 100 μg/ml ampicillin, 50 μg/ml kanamycin. After overnight growth the cultures were centrifuged at 4,000 r.p.m. for 10 minutes and the supernatants collected. ELISA plates used to screen THYPAN3 clones were coated at 37° C. overnight with 200 μg/ml thyroglobulin in 50 mM NaHCO3pH9.6. Plates used for OXPAN2 and OXPAN3 were coated at 100 μg/ml OX-BSA in PBS at 37° C. overnight. - 120 μl of culture supernatant was mixed with 30 μl of 5×PBS, 10% milk powder and incubated at room temperature for 2 hours at room temperature. ELISAs were carried out as described in example 18.
- For thyroglobulin, 18 out of 40 clones were positive (0.3-2.0 O.D. after 30 minutes). (A phage control (vector pCAT3) gave a reading of 0.07 O.D.). In addition, positives were also seen on the polyclonal phage preparations THYPAN1 (0.314 O.D.) and THYPAN2 (0.189 O.D.) compared with phage derived from the original non-panned phagemid library (0.069 O.D.). All polyclonal phage were PEG precipitated and used at a 10 fold concentration.
- PCR reactions and BstN1 digests were carried out on the positive clones as described above and six different patterns of DNA fragments were obtained showing that at least six different clones had been isolated.
- For OX-BSA after two rounds of panning, 30 of 48 clones were positive by ELISA and after three rounds, 42 of 48 were positive. In a separate experiment, positive signal was obtained from the polyclonal phage preparations OXPAN1 (0.988 OD) and OXPAN2 (1.717 OD) compared with phage derived from the original non-panned phagemid library (0.186 O.D.) after 30 minutes.
- Specificity of Clones for Thyroglobulin or OX-BSA
- Selected clones (11 anti-thyroglobulin, 5 anti-OX-BSA) representing each of the different BstNI restriction digest patterns were assayed for binding to a panel of irrelevant antigens. ELISA plates were coated with antigen (100 μl/ml in 50 mM NaHCO3, pH 9.6) by overnight incubation at 37° C. The panel of antigens consisted of keyhole limpet haemocyanin, hen egg lysozyme, bovine serum albumin, ovalbumin, cytochrome c, chymotrysinogen, trypsin inhibitor, GAP-D11 (glyceraldehyde-3-phosphate dehydrogenase), bovine thyroglobulin and oxazolone-BSA. Duplicate samples of phage supernatant (80 μl+20
μl 5×PBS, 10% milk powder) were added to each antigen and incubated for 1 hour at room temperature. The ELISA was carried out as described in example 18. - Each of the thyroglobulin specific clones (11 from 11) were positive for thyroglobulin (OD 0.12-0.76) but after 60 minutes showed no binding (OD<0.03) to any of the 9 irrelevant antigens. Similarly of the 5 OX-BSA
specific clones 3 had an OD 0.07-0.52 compared to ODs <0.02 for the irrelevant antigens. None of the 5 clones had any binding to BSA alone. - Thus positive clones can be isolated after only two rounds of panning by rescuing with M13KO7gIII No. 3. In addition there is a greater likelihood with this helper of generating phage particles with more than one intact antibody molecule. This will potentially increase the avidity of phage-antibodies and may enable isolation of clones of weaker affinity.
- Alteration of Fine Specificity of scFv D1.3 Displayed on Phage by Mutagenesis and Selection on Immobilised Turkey Lysozyme
- The D1.3 antibody binds hen egg lysozyme (HEL) with an affinity constant of 4.5×107M−1 whereas it binds turkey egg lysozyme (TEL) with an affinity of <1×105M−1. (Harper et al (1987) Molecular Immunology 24 p 97-108, Amit et al (1986) Science 233 p 747-753).
- It has been suggested that this is because the glutamine residue present at position 121 of HEL (gln121) is represented by histidine residue at the same position in TEL. Thus mutagenising the D1.3 antibody residues which interact with gln121 of HEL may facilitate binding to TEL.
- According to Amit et al, supra, tyrosine at
amino acid position 32, phenylalanine at position 91 and tryptophan at position 92 of the light chain interact with gln121 of HEL. In addition tyrosine atposition 101 of the heavy chain also interacts. None of these residues are predicted to be involved in determining the main chain conformation of the antibody variable regions (Chothia and Lesk (1987) Journal ofMolecular Biology 196, p 901-917). - Mutagenesis of pCAT3SCFvD1.3
- The oligonucleotides mutL91,92, was prepared to randomise phenylalanine at position 91 (L91) and tryptophan at position 92 (L92) of the light chain. The oligonucleotides mutL32, was prepared to randomise tyrosine at light chain position 32 (L32) and the oligonucleotides mutH101 was prepared to randomise tyrosine at
position 101 of the heavy chain (H101).mutL91, 92: 5′ CGT CCG AGG AGT ACT NNN NNN ATG (SEQ ID NO:75) TTG ACA GTA ATA 3′mutL32: 5′ CTG ATA CCA TGC TAA NNN ATT GTG (SEQ ID NO:76) ATT ATT CCC 3′mutH101: 5′ CCA GTA GTC AAG CCT NNN ATC TCT (SEQ ID NO:77) CTC TCT GGC 3′
(N represents a random insertion of equal amounts of A, C, G or T) in vitro mutagenesis of the phagemid vector, pCAT3scFvD1.3 (example 17) with the oligonucleotide mutL91,92 was carried out using an in vitro mutagenesis kit (Amersham). The resultant DNA was transformed by electroporation into TG1 cells using a Bio-Rad electroportor. 78,000 clones were obtained and these were scraped into 15 mls of 2×TY/20% glycerol. This pool was called D1.3L91L92. Single stranded DNA was prepared by rescue with M13K07 as described in Sambrook et al, 1989 supra, and sequenced with the primer FDTSEQ1, using a Sequenase sequencing kit (United States Biochemical Corporation). - This revealed that the DNA had been successfully mutagenised as judged by the presence of bands in all four DNA sequencing tracks at the nucleotide positions encoding L91 and L92. This mutagenised single stranded DNA was subjected to a further round of mutagenesis as above using either mutL32 or mutH101 oligonucleotides. Mutagenesis with mutL32 gave rise to 71,000 clones (pool called D1.3L32) while mutH101 gave 102,000 clones (pool called D1.3H101). These clones were scraped into 15 mls of 2×TY/20% glycerol. Single stranded DNA derived from each pool was sequenced with the oligonucleotides D1.3L40 and LINKSEQ1 respectively, as described above, and shown to be correctly randomised.
D1.3L40: 5′ CAG GAG CTG AGG AGA TTT TCC 3′LINKSEQ1: 5′ TCC GCC TGA ACC GCC TCC ACC 3′
Preparation of Rescued Phage for Affinity Purification - 10-20 μl of bacteria derived from each mutagenised pool (plate scrapes) was used to inoculate 5 mls of TY/Glu/Amp. All bacterial growth was at 37° C. After 2-3 hours growth, 1 ml was diluted in 5 mls of prewarmed TY/Glu/Amp and infected by addition of 0.5 mls of a 200 fold concentrate of the M13K07gIII Δ No. 3 preparation described in example 34. After 1 hour of infection the cultures were centrifuged at 4,000 r.p.m. for 10 minutes, resuspended in 2×TY, 100 μg/ml ampicillin, incubated for a further hour, transferred to 500 mls of 2×TY medium containing 100 μg/ml ampicillin, 50 μg/ml kanamycin and grown for 16 hours. The remaining steps of phage preparation were as described in example 44. Phage were finally dissolved in 10 mM Tris, 1 mM EDTA pH7.4 at 1/100th the original culture volume.
- Affinity Purification
- 10 mls of turkey egg lysozyme at a concentration of 10 mg/ml in 0.1M NaHCO3, 0.5MNaC1 pH8.3 was mixed with an equal volume of swollen Cyanogen Bromide Activated Sepharose 4B (Pharmacia), covalently linked and washed according to manufacturers instructions. Before use this matrix (TEL-Sepharose) was washed with 100 volumes of PBS followed by 10 volumes of PBSM. The TEL-Sepharose was resuspended in an equal volume of PBSM and 1 ml was added to 1 ml of a 50 fold concentrate of phage in PBSM and incubated on a rotating platform for 30 minutes at room temperature. The actual phage used for this step was prepared by mixing equal volumes of the independent preparations of the three randomised pools (D1.3L9192, D1.3H101 and D1.3L32). After this binding step, the suspensions were loaded onto a disposable polypropylene column (Poly-Prep columns, Bio-Rad) and washed with 200 volumes of PBS containing 0.1
% Tween 20. Bound phage were eluted with 1 ml of 100 mM triethylamine and neutralised with 0.5 ml 1M Tris (pH7.4). A dilution series was prepared from the eluate and used to infect TG1 cells and plated out on TY plates containing 100 μg/ml ampicillin, 2% glucose. Plates carrying approximately 106 colonies were scraped into 3 mls of 2×TY, 20% glycerol and stored at −70° C. 10 μl of this was used to initiate a second round culture which was rescued with M13K07gIIIΔ No. 3 as described above (using a final culture volume of 100 mls). Second and third round affinity column purification steps were carried out as described above for the first round. - Analysis by ELISA
- 40 colonies derived from the third round of column purification on TEL-Sepharose were picked into a 96 well plate and grown overnight at 37° C. in 200 μl of TY/Amp/Glu. Phagemid particles were rescued and prepared for ELISA as described in example 18. ELISA plates were coated overnight at 37° C. with hen egg lysozyme (HEL) or turkey egg lysozyme (TEL) at a concentration of 200 μg/ml in 50 mM NaHCO3 pH9.6 ELISAs were carried out as described in example 18.
- After 15 minutes incubation in substrate, 13 clones were found to be negative (OD<0.05 on HEL and TEL). In all positives, a signal of 0.1-0.78 was scored on HEL with the exception of one where signal on HEL was 0.078 but signal on TEL (OD 0.169) brought it in to the positive group. The control phagemid preparation had a percentage ratio of signal TEL:HEL of 22%. Clones were deemed to have an unaltered binding if the ratio of TEL:HEL was less than 40%. 9 clones fell into this category. 18 samples were scored as having altered binding with a ratio of signal on TEL:HEL of between 40-200%.
- A dilution series was made on 10 clones which were analysed by ELISA in 6 of these clones the profile of binding to HEL was the same as the original clone (pCAT3SCFvD1.3) while the signal with TEL was increased (see
FIG. 50 a clone B1). In the remaining 4 clones, the increased signal with TEL was accompanied by a decrease in signal on HEL (seeFIG. 50 clone A4). - Competition with Soluble Antigen
- All of the isolated clones retained binding to HEL to varying extents. In order to determine whether a soluble antigen could compete with the immobilised antigen, a parallel experiment was carried out, as above, but with the addition of hen egg lysozyme (1 mg/ml) to TEL-Sepharose before incubating with the phage preparation. This experiment was carried through 3 rounds of column purification and 40 colonies were picked. None of these clones bound HEL or GEL demonstrating that the soluble antigen had been successful in competing out binding to the immobilised antigen.
- Modification of the Specificity of an Antibody by Replacement of the VLK Domain by a VLK Library Derived from an Unimmunised Mouse
- When an antibody specificity is isolated it will often be desirable to alter some of its properties particularly its affinity or specificity. This example demonstrates that the specificity of an antibody can be altered by use of a different VL domain derived form a repertoire of such domains. This method using display on phage would be applicable to improvement of existing monoclonal antibodies as well as antibody specificities derived using phage antibodies. This example shows that replacement of the VL domain of scFvD1.3 specific for Hen eggwhite lysozyme (HEL) with a library of VL domains allows selection of scFv fragments with bind also to Turkey eggwhite lysozyme (TEL). More generally this experimental approach shows that specificities of antibodies can be modified by replacement of a variable domain and gives a further example of the hierarchical approach to isolating antibody specificities.
- The D1.3 heavy chain was amplified from an existing construct (pSW1-VHD1.3, Ward et al., 1989 supra) by PCR using the primers VH1BACK and VH1FOR, the light chain library was amplified from a cDNA library derived from the spleen of an unimmunised mouse, which was synthesized by using the
MJKFONX primers - Cloning the assembled PCR products (scFv sequences) was done after an additional PCR step (pull-through) using a BACK primer providing an ApaLI site and forward primers which contained a
Not 1 site as described in example 14. ApaL1/Not 1 digested PCR fragments were cloned into the similarly digested vector fdCAT2 as in example 11. 5×105 transformations were obtained after electroporation of the ligation reaction into MC1061 cells. - Screening of the phage library for TEL binders was performed by panning. Polystyrene Falcon 2058 tubes were coated (16 hrs) with 2 ml of TEL-PBS (3 mg/ml) and blocked for 2 hrs with 4 ml MPBS (PBS containing 2% skimmed milk powder). Phage derived from the library (5×1010 transducing unites) in 2 ml of MPBS (2%) were incubated in these tubes for 2 hrs at room temperature. The tubes were washed 3× with PBS, 1× with 50 mM Tris-HCl, pH 7.5, 0.5 M NaCl; 1× with 50 mM Tris-HCl, pH8.5, 0.5 M NaCl, 50 mM Tris-HCl, pH 9.5 M NaCl. Finally phage were eluted with 100 mM triethylamine. Eluted phages were taken to infect TG1 cells, the cells were plated on 2×TY plates containing 15 μg/ml tetracycline and grown for 16 h. The colonies were scraped into 25 ml of 2×Ty medium and the phages were recovered by PEG precipitation. After a second round of selection for TEL binders ELISAs were performed as described (example 2).
- Analysis of 100 clones from the library before affinity selection by ELISA on plates coated with TEL showed no binders. In contrast, after two rounds of selection for TEL binding phages about 10% of the phage clones showed positive ELISA signals. ELISA signals were scored positive with values at least two fold higher than the fdCAT2 vector without insert. A more detailed analysis of binding properties of TEL binding phages is shown in
FIG. 51 . - As shown in
FIG. 51 , several clones were found which bind equally to TEL and HEL in contrast to the original D1.3 scFv, which binds almost exclusively to HEL. None of the clones bound to BSA. These findings indicate that the specificity of these scFvs was broader in comparison to D1.3, since both lysozymes (HEL and TEL) are recognized, but specificity for lysozyme was retained since other BSA was not recognized. The deduced amino acid sequences (derived by DNA sequencing) of two light chains from clones MF1 and M21, which correspond toclones FIG. 51 are shown inFIG. 52 . - In the case of isolated antibodies the experimental approach as described in this study may be particularly useful if recognition of a wider range of different but closely related antigens is desired. For example, monoclonal antibodies against viral antigens viral antigens like V3 loop of HIV-1 gp120 are in most cases quite specific for one particular virus isolate because of the variability in this part of the HIV-1 env gene. The modification of such antibodies in the way described in this example may lead to antibodies which cross react with a wider range of HIV-1 isolates, and would therefore be of potentially higher therapeutic or diagnostic value.
- A similar approach could be taken in which a light chain variable domain of desired properties is kept fixed and combined with a library of heavy chain variable domains. Some heavy chains, for example VHD1.3 retain binding activity as single domains. This may allow a strategy where VH domains are screened for binding activity when expressed on phage and then binding domains combined with a library of VL domains for selection of suitable light chain partners.
- Selection of a Phage Antibody Specificity by Binding to an Antigen Attached to Magnetic Beads. Use of a Cleavable Reagent to Allow Elution of Bound Phage Under Mild Conditions
- When a phage antibody binds to its antigen with high affinity or avidity it may not be possible to elute the phage antibody from an affinity matrix with a molecule related to the antigen. Alternatively, there may be no suitable specific eluting molecule that can be prepared in sufficiently high concentration. In these cases it is necessary to use an elution method which is not specific to the antigen-antibody complex. Unfortunately, some of the non-specific elution methods disrupt phage structure, for instance phage viability is reduced with time at pH12 (Rossomando, E. F. and Zinder, N. D. J. Mol. Biol. 36 387-399 1968). A method was therefore devised which allows elution of bound phage antibodies under mild conditions (reduction of a dithiol group with dithiothreitol) which do not disrupt phage structure.
- Target antigen was biotinylated using a cleavable biotinylation reagent. BSA conjugated with 2-phenyl-5-oxazolone (O. Makela et al. supra) was modified using a biotinylation reagent with a cleavable dithiol group (sulphosuccinimidyl2-(biotinamido)ethyl-1,3-dithiopropionate from Pierce) according to the manufacturers instructions. This biotinylated antigen was bound to streptavidin coated magnetic beads and the complex used to bind phage. Streptavidin coated magnetic beads (Dynal) were precoated with antigen by mixing 650 μg of biotinylated OX-BSA in 1 ml PBS, with 200 μl of beads for at least 1 hour at room temperature. Free antigen was removed by washing in PBS. One fortieth of the complex (equivalent to 5 μl of beads and an input of 17.5 μg of OX-BSA) was added to 0.5 ml of phage in PBSM (PBS containing 2% skimmed milk powder) containing 1.9×1010 phage particles mixed at the ratios of pAbD1.3 directed against lysozyme (example 2) to pAbNQ11 directed against 2-phenyl-5-oxazolone (example 11) shown in Table 12.After 1 hour of incubation with mixing at room temperature, magnetic beads were recovered using a Dynal MPC-E magnetic desperation device. They were then washed in PBS containing 0.5
% Tween 20, (3×10 minutes, 2×1 hour, 2×10 minutes) and phage eluted by 5 minutes incubation in 50 μl PBS containing 10 mM dithiothreitol. The eluate was used to infect TG1 cells and the resulting colonies probed with the oligo NQ11CDR3 (5′AAACCAGGCCCCGTAATCATAGCC 3′) (SEQ ID NO:80) derived from CDR3 of the NQ11 antibody (This hybridises to pAbNO11 but not pAb D1.3). - A 670 fold enrichment of pAbNQ11 (table 12) was achieved form a background of pAbD1.3 in a single round of purification using the equivalent of 17.5 μg of biotinylated OX-BSA.
- This elution procedure is just one example of an elution procedure under mild conditions. A particularly advantageous method would be to introduce a nucleotide sequence encoding amino acids constituting a recognition site for cleavage by a highly specific protease between the foreign gene inserted, in this instance a gene for an antibody fragment, and the sequence of the remainder of gene III. Examples of such highly specific proteases are Factor X and thrombin. After binding of the phage to an affinity matrix and elution to remove non-specific binding phage and weak binding phage, the strongly bound phage would be removed by washing the column with protease under conditions suitable for digestion at the cleavage site. This would cleave the antibody fragment from the phage particle eluting the phage. These phage would be expected to be infective since the only protease site should be the one specifically introduced. Strongly binding phage could then be recovered by infecting, e.g., E. coli TG1 cells.
- Use of Cell Selection to Provide an Enriched Pool of Antigen Specific Antibody Genes, Application to Reducing the Complexity of Repertoires of Antibody Fragment Displayed on the Surface of Bacteriophage
- There are approximately 1014 different combinations of heavy and light chains derived from the spleen of an immunised mouse. If the random combinatorial approach is used to clone heavy and light chain fragments into a single vector to display scFv, Fv or Fab fragments on phage, it is not a practical proposition to display all 1014 combinations. One approach, described in this example, to reducing the complexity is to clone genes only from antigen selected cells. (An alternative approach, which copes with the complexity is the dual combinatorial library described in example 26).
- The immune system uses the binding of antigen by surface immunoglobulin to select the population of cells that respond to produce specific antibody. This approach of selecting antigen binding cells has been investigated to reduce the number of combinatorial possibilities and so increase the chance of recovering the original combination of heavy and light chains.
- The immunological response to the hapten 4-hydroxy-3-nitrophenylacetic acid (NP) has been extensively studied. Since the primary immune response to NP uses only a single light chain the applicants were able to examine the use of the combinatorial method using a fixed light chain and a library of heavy chains to examine the frequencies genes that code for antibodies binding to NIP (4-hydroxy-3-iodo-5-nitrophenylacetic acid). The applicants have thus used this system to investigate the merits of selecting cell populations prior to making combinatorial libraries for display on phage.
- Methods
- 2.1 Hapten Conjugates
- Chick gamma globulin (CGG, Sigma, Poole, UK) and Bovine serum albumen (BSA, Boehringer, Mannheim, Germany) were conjugated with NP—O-succinimide or NIP-caproate-O-succinimide (Cambridge Research Biochemicals, Northwich, UK) based on the method described by Brownstone (Brownstone, A., Mitchison, N. A. and Pitt-Rivers, R., Immunology 1966. 10: 465-492). The activated compounds were dissolved in dimethylformamide and added to proteins in 0.2 M sodium hydrogen carbonate. They were mixed with constant agitation for 16 hours at 4° C. and then dialysed against several changes of 0.2 M sodium hydrogen carbonate. They were finally dialysed into phosphate buffered saline (PBS). The conjugates made were NP12CGG, NIP10BSA. The NIP10BSA derivative was subsequently biotinylated using a biotinylation kit purchased from Amersham (Amersham International, Amersham, UK).
- 2.2 Animals and Immunisation
- Mice of the strain C57BL/6 were immunised by intraperitoneal injection of 100 μg NP-CGG in Complete Freunds Adjuvant at 10 weeks of age.
- 2.3 Spleen Preparation
- Seven days after immunization cells from the spleen were prepared as described by Galfre and Milstein (Galfre, G. and Milstein, C. Methods Enzymol. 1981. 73:3-46). Red cells were lysed with ammonium chloride (Boyle, W. Transplantation 1968.6:71) and when cell selection was performed dead cells were removed by the method described by von Boehmer and Shortman (von Boehmer, H. and Shortman, K, J. Immunol, Methods 1973:1:273). The cells were suspended in phosphate buffered saline (PBS), 1% Bovine serum albumen, 0.01% sodium azide; throughout all cell selection procedures the cells were kept at 4° C. in this medium.
- 2.4 Cell Solution
- Biotinylated NIP-BSA was coupled to streptavidin coupled magnetic beads (Dynabeads M280 Streptavidin, Dynal, Oslo, Norway) by incubating 108 beads with 100 μg of biotinylated protein for 1 hour, with occasional agitation, and then washing five times to remove unbound antigen. The coupled beads were stored at 4° C. in medium until required. For selection of antigen binding cells the cells (2-4×107/ml) were first incubated for 30 minutes with uncoupled beads, at a bead: cell ratio of 1:1, to examine the degree of non-specific binding. The beads were then separated by placing the tube in a magnetic device (MPC-E Dynal) for 3-5 minutes. The unbound cells were removed and then incubated with NIP-BSA coupled magnetic beads, at a bead:cell ratio of 0.1:1, for 60 minutes, with occasional agitation. The beads and rosetted cells were separated as described above. The beads were then resuspended in 1 ml of medium and the separation repeated; this process was repeated 5-7 times until no unbound cells could be detected when counted on a haemocytometer.
- For the depletion of surface immunoglobulin positive cells the cells were incubated with 20 μg biotinylated goat anti-mouse polyvalent immunoglobulin (Sigma, Poole, UK). The cells were then washed twice with medium and added to streptavidivin coupled magnetic beads at a bead to cell ratio of 30:1. After 30 minutes incubation the beads and rosetted cells were separated by applying the magnetic device three times - taking the supernatant each time.
- 2.4 DNA/cDNA Preparation, PCR Amplification and Cloning
- DNA was prepared by a simple proteinase-K digest method that was particularly convenient for small numbers of cells (PCR Protocols: A Guide to Methods and Applications. Ed Innis M. A., Gelfand D. H., Sninsky J. J. and White T. J. Academic Press). RNA preparation and subsequent cDNA synthesis was performed as described by Gherardi et al (Gherardi E., Pannell R. and Milstein C. J. Immunol. Methods, 1990. 126:61-68). PCR and cloning of the heavy chain libraries was performed using the primers and conditions described by Ward et al (Ward, E. S., Güssow, D., Griffiths, A. D., Jones, P. T. and Winter, G., Nature, 1989. 341: 544-546); 40 cycles of PCR amplification were performed. The VH and Fv expression vectors used were adapted from those previously described by Ward et al. They were both subcloned into pUC119 (Veira and Messing see later) and the Fv expression vector was modified to include a germline lambda-1 light chain (obtained as a gift from T. Simon (originally cloned by Siegfried Weiss, Basel Institute of Immunology)). THe vector is shown in
FIG. 53 . - 2.5 Expression and ELISA
- For screening single colonies were picked into individual wells of microtitre plates (Bibby) in 200
μl 2×TY/Ampicillin 100 μg/ml/0.1% glucose and then incubated at 37° C. for 5-6 hours with agitation, Isopropyl-β-D-thiogalactopyranoside (IPTG, Sigma, Poole, UK) was then added to a final concentration of 1 mM and the incubation continued for a further 16 hours at 30° C. before harvesting the supernatants. The wells of Falcon ELISA plates (Becton Dickenson, N.J., USA) were coated overnight at room temperature with NIP10-BSA (40 μg/ml in PBS) and then blocked with 2% skimmed milk powder in PBS for 2 hours at room temperature. The bacterial supernatants were added and incubated at room temperature for 1 hour and then the plates were washed three times with PBS. Peroxidase conjugated-Goat anti-mouse lambda-chain (Southern Biotechnology, Birmingham, USA) was added and again incubated for 1 hour at room temperature before washing six times with PBS and then developing with 2,2′-Azino-bis (3-ethylbenzthiazoline-6-sulfonic acid) (Sigma, Poole, UK) as the peroxidase substrate. The optical density at 405 nm was measured using a Thermomax microplate reader (Molecular Devices, Menlo Park, USA) after 30 minutes. Western blotting using the C-terminal myc tag as described in example 27. - 3.1 Comparison of RNA/DNA and Antigen Selected Cells
- The results of antigen selection are shown in Table 13. Less than 1% of cells bind to NIP-BSA coated beads and the non-specific binding is very low. Assessment of the proportion of expressed genes from each VH library using western blotting showed that full length VH domains were expressed in 95% ( 19/20) of all clones when RNA was used as the starting material but only 60% ( 12/20) of clones when DNA (either selected cells or from total spleen) was used as the starting material. This difference probably results from the fact that many re-arranged pseudogenes could be amplified with our primers and it appears that there must be some degree of selection, at the level of transcription, for functional genes.
- A variable number of clones from each type of library were screened for the production of Fv fragments that bound to NIP. Initial screening ELISAs were performed and positives taken to include those with an optical density of at least twice the background. The initial positives were retransformed and the binding checked in duplicate; it was confirmed that the binding was specific to NIP and not to BSA. The frequency of confirmed positive NIP binding clones for each starting material are shown in Table 14. Using DNA as the starting material for the PCR amplification is approximately equivalent to sampling the cells present as there is only one functional re-arranged heavy chain gene and at most one re-arranged pseudogene per B-cell. Amplifying from the RNA of an animal of course biases the repertoire to the reacting B-cells and in a recently immunised animal this would be expected to give some bias towards the immunogen. The data in Table 14 clearly shows how powerful this selection is with the number of antigen specific genes being enriched at least 96 fold when RNA made one week after primary immunisation is used as the starting material. The data also show that selection for antigen binding cells also provides an alternative powerful method of selection for the required genetic starting material.
- 3.2 Comparison of Total Spleen/Surface Immunoglobulin Depleted Spleen
- To examine the cellular basis of the selection achieved by using RNA as the starting material we depleted the spleen of surface immunoglobulin positive cells using biotinylated anti-polyvalent immunoglobulin and streptavidin conjugated magnetic beads. Prior FACS analysis had demonstrated that this method removed over 96% of surface immunoglobulin positive cells. RNA was prepared from both surface immunoglobulin depleted and non-depleted factions of a spleen and VH libraries made from each. The ELISA results (Table 14) show that the number of positives is certainly not decreased by this depletion suggesting that the major portion of the selective effect of using RNA may come from surface immunoglobulin negative G-cells (probably plasma cells).
- The applicants have demonstrated the importance of the amplification of specific RNA produced by immunisation to enable binding activity to be obtained with any reasonable frequency from a combinatorial library. The applicants have also demonstrated an alternative strategy which mimics that of the immune system itself. Using a simple method of selecting for antigen binding cells gave comparable enrichment and has the added advantage of using a broader range of genes. At first sight the random combinatorial approach would appear unlikely to produce the original combination of heavy and light chain because of the vast diversity of the immunoglobulin genes. The applicants show here, however, that following immunisation, with a good antigen, 10% of the VH genes from total splenic RNA isolated come from antigen specific cells so the effective size of the repertoire is greatly reduced. This together with the fact that promiscuity of the heavy and light chains occurs (examples 21 and 22) accounts for the fact that combinatorial system does produce antigen binding clones with reasonable frequency. The data also suggests that the bulk of the antigen specific RNA comes from surface immunoglobulin negative cells which are most likely plasma cells.
- The data also show that this simple method of antigen selection may be useful in reducing the complexity of the combinatorial library. In this case an enrichment of antigen specific genes of at least 56 fold has been achieved which in the normal case where heavy and light chains are unknown would result in a reduction of the complexity of the combinatorial library by a factor of over 3000. A further advantage of using antigen selected cells (and amplifying from DNA to reduce any bias due to the state of the cell) is that this results in a broader range of antibody genes amplified. It may be that a simple cell selection such as that the applicants have described here in combination with phage selection would be ideal. From this example it can be seen that by combining cell and phage selection methods one could reasonably expect to screen all the combinations of heavy and light chain (approximately 4×1010) and would thus be able to screen all binding combinations although this would not, at present, be possible from whole spleen (approximately 4×1014 combinations, assuming 50% B-cells).
TABLE 1 Enrichment of pAb (D1.3) from vector population OUTPUT RATIO ELISAc INPUT RATIOa oligob pAb:total pAb:fd-CAT1 pAb:total phage phage ENRICHMENTd Single Round 1:4 × 103 43/124 1.3 × 103 1:4 × 104 2/82 1.0 × 103 Two Rounds 1:4 × 104 197/372 2.1 × 104 1:4 × 105 90/356 3/24 1.0 × 105 1:4 × 106 27/183 5/26 5.9 × 105 1:4 × 107 13/278 1.8 × 106
Footnotes:
aApproximately 1012 phage with the stated ratio of pAb (D1.3):FDTPs/Bs were applied to 1 ml lysozyme-sepharose columns, washed and eluted.
bTG1 cells were infected with the eluted specific binding phage and plated onto TY-tet plates. After overnight incubation at 30-37° C., the plates were analysed by hydridisation to the 32p, labelled oligonucleotide VH1FOR (Ward et al op cit) which is specific to pAb D1.3.
cSingle colonies from overnight plates were grown, phage purified, and tested for lysozyme binding.
dEnrichment was calculated from the oligonucleotide probing data.
-
TABLE 2 Enrichment of pAb (D1.3) from mixed pAb population Input Ratio1 Output Ratio2 (pAbD1.3:pAbNQ11) (pAb D1.3:Total phage) Enrichment Single Round 1:2.5 × 104 18/460 0.98 × 103 1:2.5 × 105 3/770 0.97 × 103 1:2.5 × 106 0/112 — pAb NQ11 only 0/460 — Second Round 1:2.5 × 104 119/170 1.75 × 104 1:2.5 × 105 101/130 1.95 × 105 1:2.5 × 106 102/204 1.26 × 106 1:2.5 × 107 0/274 — 1:2.5 × 108 0/209 — pAb NQ11 only 0/170 —
Notes
11010 phage applied to a lysozyme column as in table 1.
2Plating of cells and probing with oligonucleotide as in table 1, except the oligonucleotide was D1.3CDR3A.
-
TABLE 3 Enzyme activity of phage-enzyme No. of molecules of Enzyme ng of enzyme Rate equivalent Input or No. of phage (OD/hr) (×10−11) Pure Enzyme 335 34 24.5 Pure Enzyme 177.5 17.4 12.25 Pure Enzyme 88.7 8.7 6.125 Pure Enzyme 44.4 4.12 3.06 Pure Enzyme 22.2 1.8 1.5 Pure Enzyme 11.1 0.86 0.76 No Enzyme 0 0.005 0 fd-phoAla166/TG1 1.83 × 1011 5.82 4.2 fd-CAT2/TG1 1.0 × 1012 0.155 0.112 fd-phoAla166/KS272 7.1 × 1010 10.32 7.35 fd-CAT2/KS272 8.2 × 1012 0.038 0.027 -
TABLE 4 Affinity selection of hapten-binding phage. Clones binding to phOx† Pre-column After first round After second round After third round A Random Combinatorial Libraries phOx-immunised mice 0/568 (0%) 48/376 (13%) 175/188 (93%) Unimmunised mice 0/388 (0%) B Hierarchical Libraries VH-B/Vκ- rep library 6/190 (3%) 348/380 (92%) VH-rep/Vκ- d library 0/190 (0%) 23/380 (7%) C Fractionation of VH-B/Vκ-d and VH-B/Vκ-b phage† Mixture of clones 88/1896 (4.6%) 55/95 (57.9%) 1152/1156 (99.7%) 1296/1299 (99.8%) [44/1740 (2.5%)*]
†In panel C, numbers refer to VH-B/Vκ-d colonies.
*Numbers after three reinfections and cycles of growth. This control, omitting the column steps, confirms that a spurious growth or infectivity advantage was not responsible for the enrichment for clone VH-B/Vκ-d.
-
TABLE 5 Binding to Chain(s) Chain as Soluble Phage/Phagemid† Helper Phage phOx* displayed# gene III fusion# chain(s)# A fd CAT2 non binding none fd CAT2-I binding scFv scFv fd CAT2-II binding Fab light chain heavy chain pHEN1 VCSMB non binding none pHEN1 I VCSMB binding scFv scFv pHEN1 II VCSMB binding Fab light chain heavy chain B pHEN1 I (HB2151) binding scFv§ pHEN1 II (HB2151) binding Fab§ C fd CAT2-III non binding heavy chain heavy chain fd CAT2-IV non binding light chain light chain pHEN1 III (HB2151) VCSMB non binding none heavy chain pHEN1 III (HB2151) fd-tet-DOG1 IV binding Fab light chain heavy chain pHEN1 IV (HB2151) VCSMB non binding none light chain pHEN1 IV (HB2151) fd-tet-DOG1 III binding Fab heavy chain light chain
Overview of phOx-BSA ELISA results of phage and phagemid constructions.
*Phase were considered to be ‘binding’ if OD405 of sample was at least 10 fold greater than background in ELISA;
† E. coli TG1 was used for the growth of the phage unless the use of E. coli HB2151 is specifically indicated;
#Information deduced from genetic structure and in accordance with binding data;
§Result confirmed experimentally by Western blot (for Fab, seeFIG. 29 .
-
TABLE 6 Kinetic parameters of soluble and phage-bound alkaline phosphase. Relative values of kcat and Km for the soluble enzyme and for the phage enzyme were derived by comparing with the values for wild type enzyme (phoArg166) and the phage-wild type enzyme (fdphoArg166). Soluble enzyme (Data from Chaidaroglu Phage enzyme et al 1988) (Data from this study) phoArg166 phoAla166 phoArg166 phoAla166 Km (μM) 12.7 1620 73 1070 Relative K m1 127 1 14.6 Relative 1 0.397 1 0.360 kcat Relative 1 0.0032 1 0.024 kcat/Km -
TABLE 7 Enzyme Activity of Phage Samples SPECIFIC INPUT ACTIVITY PHAGE RATE (mol substrate SAMPLE PARTICLE (pmol substrate converted/mol (Construct:host) (pmol converted/min) phage/min) fdphoArg166:TG1 2.3 8695 3700 fdphoAla166:TG1 5.6 2111 380 fdphoAla166:KS272 1.8 2505 1400 fdCAT2:TG1 3.3 <1 <0.3 fdCAT2:KS272 5.6 70 12 -
TABLE 8 Affinity chromatography of phage-enzymes INFECTIVITY (Percentage of phage particles INPUT PHAGE OUTPUT PHAGE which are PARTICLE PARTICLE SAMPLE infectious) (×109) (×109) fdphoArg166 0.37% 5160 30 fdphoAla166 0.26% 3040 90 fdCAT2 4.75% 4000 2 -
TABLE 9 Mutations in scFvB18 selected by display on phage following growth in mutator strains Nucleotide mutation (base position) Amino acid mutation Number 308 Ala->Val (VH FR3) 3 703 Tyr->Asp (VL CDR3) 1 706 Ser->Gly (VL CDR3) 1 724 Gly->Ser (VL FR4) 21 725 Gly->Asp (VL FR4) 3 734 Thr->Ile (VL FR4) 1 -
TABLE 10 Oligonucleotide primers used for PCR of human immunoglobulin genes Oligo Name Sequence Human VH Back Primers HuVH1aBACK 5′-CAG GTG CAG CTG GTG CAG TCT GG-3′ (SEQ ID NO:81) HuVH2aBACK 5′-CAG GTC AAC TTA AGG GAG TCT GG-3′ (SEQ ID NO:82) HuVH3aBACK 5′-GAG GTG CAG CTG GTG GAG TCT GG-3′ (SEQ ID NO:83) HuVH4aBACK 5′-CAG GTG CAG CTG CAG GAG TCG GG-3′ (SEQ ID NO:84) HuVH5aBACK 5′-GAG GTG CAG CTG TTG CAG TCT GC-3′ (SEQ ID NO:85) HuVH6aBACK 5′-CAG GTA CAG CTG CAG CAG TCA GG-3′ (SEQ ID NO:86) HuVH1aBACKSfi 5′-GTC CTC GCA ACT GCG GCC CAG CCG GCC ATG GCC CAG (SEQ ID NO:87) GTG CAG CTG GTG CAG TCT GG-3′ HuVH2aBACKSfi 5′-GTC CTC GCA ACT GCG GCC CAG CCG GCC ATG GCC CAG (SEQ ID NO:88) GTC AAC TTA AGG GAG TCT GG-3′ HuVH3aBACKSfi 5′-GTC CTC GCA ACT GCG GCC CAG CCG GCC ATG GCC GAG (SEQ ID NO:89) GTG CAG CTG GTG GAG TCT GG-3′ HuVH4aBACKSfi 5′-GTC CTC GCA ACT GCG GCC CAG CCG GCC ATG GCC CAG (SEQ ID NO:90) GTG CAG CTG CAG GAG TCG GG-3′ HuVH5aBACKSfi 5′-GTC CTC GCA ACT GCG GCC CAG CCG GCC ATG GCC CAG (SEQ ID NO:91) GTG CAG CTG TTG CAG TCT GC-3′ HuVH6aBACKSfi 5′-GTC CTC GCA ACT GCG GCC CAG CCG GCC ATG GCC CAG (SEQ ID NO:92) GTA CAG CTG CAG CAG TCA GG-3′ Human JH Forward Primers HuJH1-2FOR 5′-TGA GGA GAC GGT GAC CAG GGT GCC-3′ (SEQ ID NO:93) HuJH3FOR 5′-TGA AGA GAC GGT GAC CAT TGT CCC-3′ (SEQ ID NO:94) HuJH4-5FOR 5′-TGA GGA GAC GGT GAC CAG GGT TCC-3′ (SEQ ID NO:95) HuJH6FOR 5′-TGA GGA GAC GGT GAC CGT GGT CCC-3′ (SEQ ID NO:96) Human Heavy Chain Constant Region Primers HuIgG1-4CH1FOR 5′-GTC CAC CTT GGT GTT GCT GGG CTT-3′ (SEQ ID NO:97) HUIgMFOR 5′-TGG AAG AGG CAC GTT CTT TTC TTT-3′ (SEQ ID NO:98) Human V Back Primers HuV 1aBACK 5′-GAC ATC CAG ATG ACC CAG TCT CC-3′ (SEQ ID NO:99) HuV 2aBACK 5′-GAT GTT GTG ATG ACT CAG TCT CC-3′ (SEQ ID NO:100) HuV 3aBACK 5′-GAA ATT GTG TTG ACG CAG TCT CC-3′ (SEQ ID NO:101) HuV 4aBACK 5′-GAC ATC GTG ATG ACC CAG TCT CC-3′ (SEQ ID NO:102) HuV 5aBACK 5′-GAA ACG ACA CTC ACG CAG TCT CC-3′ (SEQ ID NO:103) HuV 6aBACK 5′-GAA ATT GTG CTG ACT CAG TCT CC-3′ (SEQ ID NO:104) Human J Forward Primers HuJ 1FOR 5′-ACG TTT GAT TTC CAC CTT GGT CCC-3′ (SEQ ID NO:105) HuJ 2FOR 5′-ACG TTT GAT CTC CAG CTT GGT CCC-3′ (SEQ ID NO:106) HuJ 3FOR 5′-ACG TTT GAT ATC CAC TTT GGT CCC-3′ (SEQ ID NO:107) HuJ 4FOR 5′-ACG TTT GAT CTC CAC CTT GGT CCC-3′ (SEQ ID NO:108) HuJ 5FOR 5′-ACG TTT AAT CTC CAG TCG TGT CCC-3′ (SEQ ID NO:109) HuJ 1BACKNot 5′-GAG TCA TTC TCG ACT TGC GGC CGC ACG TTT GAT TTC CAC CTT (SEQ ID NO:110) GGT CCC-3′ HuJ 2BACKNot 5′-GAG TCA TTC TCG ACT TGC GGC CGC ACG TTT GAT CTC CAG CTT (SEQ ID NO:111) GGT CCC-3′ HuJ 3BACKNot 5′-GAG TCA TTC TCG ACT TGC GGC CGC ACG TTT GAT ATC CAC TTT (SEQ ID NO:112) GGT CCC-3′ HuJ 4BACKNot 5′-GAG TCA TTC TCG ACT TGC GGC CGC ACG TTT GAT CTC CAC CTT (SEQ ID NO:113) GGT CCC-3′ HuJ 5BACKNot 5′-GAG TCA TTC TCG ACT TGC GGC CGC ACG TTT AAT CTC CAG TCG (SEQ ID NO:114) TGT CCC-3′ Human Constant Region Primers HuC FOR 5′-AGA CTC TCC CCT GTT GAA GCT CTT-3′ (SEQ ID NO:115) HuC FORNot1 5′-GAG TCA TTC TCG ACT TGC GGC CGC TTA TTA AGA CTC TCC CCT (SEQ ID NO:116) GTT GAA GCT CTT-3′ HuC FORNot2 5′-GAG TCA TTC TCG ACT TGC GGC CGC AGA CTC TCC CCT GTT GAA (SEQ ID NO:117) GCT CTT-3′ Human Back Primers HuV 1BACK 5′-CAG TCT GTG TTG ACG CAG CCG CC-3′ (SEQ ID NO:118) HuV 2BACK 5′-CAG TCT GCC CTG ACT CAG CCT GC-3′ (SEQ ID NO:119) HuV 3aBACK 5′-TCC TAT GTG CTG ACT CAG CCA CC-3′ (SEQ ID NO:120) HuV 3bBACK 5′-TCT TCT GAG CTG ACT CAG GAC CC-3′ (SEQ ID NO:121) HuV 4BACK 5′-CAC GTT ATA CTG ACT CAA CCG CC-3′ (SEQ ID NO:122) HuV 5BACK 5′-CAG GCT GTG CTC ACT CAG CCG TC-3′ (SEQ ID NO:123) HuV 6BACK 5′-AAT TTT ATG CTG ACT CAG CCC CA-3′ (SEQ ID NO:124) Human Forward Primers HuJ 1FOR 5′-ACC TAG GAC GGT GAC CTT GGT CCC-3′ (SEQ ID NO:125) HuJ 2-3FOR 5′-ACC TAG GAC GGT CAG CTT GGT CCC-3′ (SEQ ID NO:126) HuJ 4-5FOR 5′-ACC TAA AAC GGT GAG CTG GGT CCC-3′ (SEQ ID NO:127) HuJ FORNOT 5′-GAG TCA TTC TCG ACT TGC GGC CGC ACC TAG GAC GGT GAC CTT (SEQ ID NO:128) GGT CCC-3′ HuJ 2- 3FORNOT 5′-GAG TCA TTC TCG ACT TGC GGC CGC ACC TAG GAC GGT CAG CTT (SEQ ID NO:129) GGT CCC-3′ HuJ 4- 5FORNOT 5′-GAG TCA TTC TCG ACT TGC GGC CGC ACY TAA AAC GGT GAG CTG (SEQ ID NO:130) GGT CCC-3′ Human Constant Region Primers HuC FOR 5′-TGA AGA TTC TGT AGG GGC CAC TGT CTT-3′ (SEQ ID NO:131) HuC FORNot1 5′-GAG TCA TTC TCG ACT TGC GGC CGC TTA TTA TGA AGA TTC TGT (SEQ ID NO:132) AGG GGC CAC TGT CTT-3′ HuC FORNot2 5′-GAG TCA TTC TCG ACT TGC GGC CGC TGC AGA TTC TGT AGG GGC (SEQ ID NO:133) TGT CTT-3′ Linker oligos Reverse JH for scFv linker RHuJH1-2 5′-GCA CCC TGG TCA CCG TCT CCT CAG GTG G-3′ (SEQ ID NO:134) RHuJH3 5′-GGA CAA TGG TCA CCC TCT CTT CAG GTG G-3′ (SEQ ID NO:135) RHuJH4-5 5′-GAA CCC TGG TCA CCG TCT CCT CAG GTG G-3′ (SEQ ID NO:136) RHuJH6 5′-GGA CCA CGG TCA CCG TCT CCT CAG GTG C-3′ (SEQ ID NO:137) Reverse IgG1-4CH1 primer for Fab linker RhuIgG1- 4CH1FOR 5′-AAG CCC AGC AAC ACC AAG GTG GAC-3′ (SEQ ID NO:138) Reverse V for scFv linker RhuV 1aBACKFv 5′-GGA GAC TGG GTC ATC TGG ATG TCC GAT CCG CC-3′ (SEQ ID NO:139) RhuV 2aBACKFv 5′-GGA GAC TGA GTC ATC ACA ACA TCC GAT CCG CC-3′ (SEQ ID NO:140) RhuV 3aBACKFv 5′-GGA GAC TGC GTC AAC ACA ATT TCC GAT CCG CC-3′ (SEQ ID NO:141) RhuV 4aBACKFv 5′-GGA GAC TGG GTC ATC ACG ATG TCC GAT CCG CC-3′ (SEQ ID NO:142) RhuV 5aBACKFv 5′-GGA GAC TGC GTG AGT GTC GTT TCC GAT CCG CC-3′ (SEQ ID NO:143) RhuV 6aBACKFv 5′-GGA GAC TGA GTC AGC ACA ATT TCC GAT CCG CC-3′ (SEQ ID NO:144) Reverse V for Fab linker RHuV 1aBACKFab 5′-GGA GAC TGG GTC ATC TGG ATG TCG GCC ATC GCT GG-3′ (SEQ ID NO:145) RHuV 2aBACKFab 5′-GGA GAC TGC GTC ATC ACA ACA TCG GCC ATC GCT GG-3′ (SEQ ID N0:146) RHuV 3aBACKFab 5′-GGA GAC TGC GTC AAC ACA ATT TCG GCC ATC GCT GG-3′ (SEQ ID NQ:147) RHuV 4aBACKFab 5′-GGA GAC TGG GTC ATC ACG ATG TCG GCC ATC GCT GG-3′ (SEQ ID NO:148) RHuV 5aBACKFab 5′-GGA GAC TGC GTG AGT GTC GTT TCG GCC ATC GCT GG-3′ (SEQ ID NO:149) RHuV 6aBACKFab 5′-GGA GAC TGC GTC AGC ACA ATT TCG GCC ATC GCT GG-3′ (SEQ ID NO:150) Reverse V for svFv linker RHuV BACK1Fv 5′-GGC GGC TGC GTC AAC ACA GAC TGC GAT CCG CCA CCG CCA GAG-3′ (SEQ ID NO:151) RHuV BACK2Fv 5′-GCA GGC TGA GTC AGA GCA GAC TGC GAT CCG CCA CCG CCA GAG-3′ (SEQ ID NO:152) RHuV BACK3aFv 5′-GGT GGC TGA GTC AGC ACA TAG GAC GAT CCG CCA CCC CCA GAG-3′ (SEQ ID NO:153) RHuV BACK3bFv 5′-GGG TCC TGA GTC AGC TCA GAA GAC GAT CCG CCA CCG CCA GAG-3′ (SEQ ID NO:154) RHuV BACK4Fv 5′-GGC GGT TGA GTC AGT ATA ACG TGC GAT CCG CCA CCG CCA GAG-3′ (SEQ ID NO:155) RHuV BACK5Fv 5′-GAC GGC TGA GTC AGC ACA GAC TGC GAT CCG CCA CCG CCA GAG-3′ (SEQ ID NO:156) RHuV BACK6Fv 5′-TGG GGC TGA GTC AGC ATA AAA TTC GAT CCG CCA CCG CCA GAG-3′ (SEQ ID NO:157) Reverse V for Fab linker RHuV BACK1Fab 5′-GGC GGC TGC GTC AAC ACA GAC TGG GCC ATC GCT GGT TGG GCA-3′ (SEQ ID NO:158) RHuV BACK2Fab 5′-GCA GGC TGA GTC AGA GCA GAC TGG GCC ATC GCT GGT TGG GCA-3′ (SEQ ID NO:159) RHuV BACK3aFab 5′-GGT GGC TGA GTC AGC ACA TAG GAG GCC ATC GCT GGT TGG GCA-3′ (SEQ ID NO:160) RHuV BACK3bFab 5′-GGG TCC TGA GTC AGC TCA GAA GAG GCC ATC GCT GGT TGG GCA-3′ (SEQ ID NO:161) RHuV BACK4Fab 5′-GGC GGT TGA GTC AGT ATA ACG TGG GCC ATC GCT GGT TGG GCA-3′ (SEQ ID NO:162) RHuV BACK5Fab 5′-GAC GGC TGA GTC AGC ACA GAC TGG GCC ATC GCT GGT TGG GCA-3′ (SEQ ID NO:163) RHuV BACK6Fab 5′-TGG GGC TGA GTC AGC ATA AAA TTG GCC ATC GCT GGT TGG GCA-3′ (SEQ ID NO:164) -
TABLE 11 Deduced protein sequences of heavy and light chains selected from unimmunized library Oxazolone binder HEAVY CHAIN VH15.4 QVQLVQSGAEVKKPGASVKVSCKASGYTFT SYGIS KVRQAPGQGLEWMG WISAYNGNTKYAQKLQG (SEQ ID NO:165) RVTMITDTSTSTAYMELRSLRSDDTAVYYCVR LLPKRTATLH YYIDVWGKGT LIGHT CHAIN VL15.4 NNYVS WYQHLPGTAPNLLIY DNNKRPS GIPDRFSGSKSGTSATLGITGLQTGDEADYYC GIWDGR (SEQ ID ND:166) BSA Binders HEAVY CHAINS VH3.5 QVQLVQSGGGVVQPGRSLRLSCAASGFTPS SYGMH WVNQAPGKGLEWVA VISYDGSNKYYADSVKG (SEQ ID NO:167) RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK TGYSSGWGY FDYWSQGT LIGHT CHAINS VL3.5 SSELTQDPAVSVALGQTVRITC QGDSLRSYYAS WYQQKPGQAPVLVIY GKNNRPS (SEQ ID NO:168) GIPDRFSGSSSGNTASLTITGAQAEDEADYYC NSRDSSGNH VVFGG Lysozyme binders: HEAVY CHAINS VH10.1 SLTCSVSGDSIS SGGYS WIRQPSGKDLEWIG SVHHSGPTYYNPSLKS (SEQ ID NO:169) RVTMSVDTSKNQFSLKLKSVTAADTAMYFCAR LGGSTWRSLYKH YYMDVWGK VH14.1 QVQLQESGPGLVKPSETLSLVCTVSGGSLS FSYWG WIRQPPGKGLEWDG YISHRGTDYNSSLQS (SEQ ID NO:175) RVTISADTSKNQFSLKLSSVTAADTAYYYCAR SFSNSFFFGY WGQTGT VH13.1 QVQLVQSGAEVKKPGQSLMISCQGSGYSFS NYWIG WVRQMPGKGLEWMG IIYPGDSDTRYSPSFQG (SEQ ID NO:171) QVTISADKSISTAYLHWSSLKASDTALYYCAR LVGGTPAY WGQGT VH16.1 QVQLVQSGAEVKKPGQSLRISCKGAGYSFS TYWIG WVRQMPGKGGEWMG IIYPDDSDTRYSPSFEG (SEQ ID NO:172) QVTISVDKSITTAYLHWSSLKA LIGHT CHAINS VK10.1 EIVLTQSPSSLSASVGDRVTITC RASQSISNYLN WTQQKPGKAPKLLIY AASTLQS (SEQ ID NO:173) GVPSRFSGSGSGTDFTLTINSLQPEDFATYYC QQTIISFP LTFGGG VL14.1 SSELTQDPAVSVAFGQTVRITC QGDSLRSSYAS WYQQEPGQAPLLVIY GENSRPS (SEQ ID NO:174) GIPDRFSGSSSGNTASLTITGAQAEDEADYYC NSRDSRGTHL EVPGG VL13.1 HVILTQPASVSGSPGQSITISC TGSSRDVGGYNYVS WYQHHPGEAPKLLTS EVTNRPS (SEQ ID NO:175) GVSNRFSGSKSGNTASLTISGLQAEDEADYFC ASYTSSKT YVFGG VL16.1 QSALTQPASVSGSPGQSITISC SGSSSDTGRYDYVS NYQHYPDKAPKLLIY EVKHRPS (SEQ ID NO:176) GISERFSASKSGNTASLTISELQPGDEADYYC ASYT -
TABLE 12 Enrichment of pAbNQ11 from pAbD1.3 background by affinity selection using Ox-BSA biotinylated with a cleavable reagent and binding to streptavidin magnetic beads Input Ratio1 Output Ratio2 (pAbD1.3:pAbNQ11) (pAb NQ11:Total phage) Enrichment 2235:1 61/197 690 22350:1 5/202 544
11.9 × 1010 phage in 0.5 ml mixed for 1 hour with 5 μl streptavidin-magnetic beads precoated with antigen (OX-BSA).
2Colonies probed with the oligonucleotide NQ11CDR3
-
TABLE 13 Results of antigenic cell selection Number % of total of Cells cells Total spleen cells 4 × 107 Cells bound to 0.8 × 104 0.02 uncoated beads Cells bound to NIP-BSA 22 × 104 0.55 coated beads -
TABLE 14 Results of Fv NIP binding ELISAs from selected cell populations: *Degree of Positives Enrichment Cell Population DNA from total spleen 0/940 — RNA from total Spleen 29/282 >96 DNA from antigen 17/282 >56 binding cells Surface Ig Selection RNA fromSurface Ig 8/94 — negative fraction RNA from total Spleen 4/94 —
*Degree of enrichment compared to total DNA.
-
Claims (10)
1. A phagemid comprising a DNA encoding a single-chain antibody-coliphage pIII fusion protein, wherein the fusion protein contains a contiguous full length coliphage pIII protein.
2. The phagemid according to claim 1 , wherein the fusion protein contains a protease-sensitive region between the antibody and the coliphage pIII protein.
3. The phagemid according to either claim 1 or claim 2 , wherein the phagemid comprises the genetic elements and DNA sequences (SEQ ID NOS: 7-17) of FIGS. 1(a)-1(c).
4. A process of producing the phagemid according to claim 1 , comprising fusing a DNA encoding the single-chain antibody to a DNA encoding the contiguous full length coliphage pIII protein and inserting the resulting DNA into a phagemid vector.
5. The process according to claim 4 , further comprising inserting a DNA encoding a protease-sensitive region between the DNA encoding the single-chain antibody and the DNA encoding the coliphage pIII protein.
6. A method of selecting antibodies from an antibody library, comprising screening said antibody library with an antigen, wherein said antibody library consists of phagemids according to either claim 1 or claim 2 .
7. A method of presenting a peptide or protein at the surface of a phagemid viral particle, comprising producing said phagemid viral particle, wherein said phagemid viral particle comprises a DNA sequence encoding said peptide or protein fused to a DNA sequence encoding a contiguous full length coliphage pIII protein.
8. A filamentous bacteriophage particle displaying on its surface as a fusion with a gene III coat protein surface component a member of a specific binding pair in functional form comprising a binding domain for a complementary specific binding pair member, the particle containing a phagemid genome which is plasmid nucleic acid containing a single stranded phage replication origin and a nucleotide sequence encoding said fusion, and the particle having a coat partially derived from a helper phage and partly from said fusion.
9. A particle according to claim 8 wherein the displayed specific binding pair member comprises a binding domain of an immunoglobulin.
10. A particle according to claim 9 wherein the specific binding pair member is a scFv molecule.
Priority Applications (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US11/555,519 US20070148774A1 (en) | 1990-07-10 | 2006-11-01 | Methods for producing members of specific binding pairs |
US12/772,829 US20100317540A1 (en) | 1990-07-10 | 2010-05-03 | Methods for producing members of specific binding pairs |
US13/165,300 US20120129710A1 (en) | 1990-07-10 | 2011-06-21 | Methods for producing members of specific binding pairs |
Applications Claiming Priority (16)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
GB9015198.6 | 1990-07-10 | ||
GB909015198A GB9015198D0 (en) | 1990-07-10 | 1990-07-10 | Binding substance |
GB909022845A GB9022845D0 (en) | 1990-07-10 | 1990-10-19 | Antibodies |
GB9022845.3 | 1990-10-19 | ||
GB9024503.6 | 1990-11-12 | ||
GB909024503A GB9024503D0 (en) | 1990-11-12 | 1990-11-12 | Binding substances |
GB919104744A GB9104744D0 (en) | 1991-03-06 | 1991-03-06 | Binding substances |
GB9104744.9 | 1991-03-06 | ||
GB9110549.4 | 1991-05-15 | ||
GB919110549A GB9110549D0 (en) | 1991-05-15 | 1991-05-15 | Binding substances |
US07/971,857 US5969108A (en) | 1990-07-10 | 1991-07-10 | Methods for producing members of specific binding pairs |
GBPCT/GB91/01134 | 1991-07-10 | ||
PCT/GB1991/001134 WO1992001047A1 (en) | 1990-07-10 | 1991-07-10 | Methods for producing members of specific binding pairs |
US08/484,893 US6172197B1 (en) | 1991-07-10 | 1995-06-07 | Methods for producing members of specific binding pairs |
US41747999A | 1999-10-13 | 1999-10-13 | |
US11/555,519 US20070148774A1 (en) | 1990-07-10 | 2006-11-01 | Methods for producing members of specific binding pairs |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US41747999A Continuation | 1990-07-10 | 1999-10-13 |
Related Child Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US12/772,829 Continuation US20100317540A1 (en) | 1990-07-10 | 2010-05-03 | Methods for producing members of specific binding pairs |
Publications (1)
Publication Number | Publication Date |
---|---|
US20070148774A1 true US20070148774A1 (en) | 2007-06-28 |
Family
ID=27516982
Family Applications (7)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US07/971,857 Expired - Lifetime US5969108A (en) | 1990-07-10 | 1991-07-10 | Methods for producing members of specific binding pairs |
US09/416,902 Expired - Fee Related US7635666B1 (en) | 1990-07-10 | 1999-10-13 | Methods for producing members of specific binding pairs |
US09/417,478 Expired - Fee Related US7723270B1 (en) | 1990-07-10 | 1999-10-13 | Methods for producing members of specific binding pairs |
US11/555,519 Abandoned US20070148774A1 (en) | 1990-07-10 | 2006-11-01 | Methods for producing members of specific binding pairs |
US11/555,464 Abandoned US20090155810A1 (en) | 1990-07-10 | 2006-11-01 | Methods for producing members of specific binding pairs |
US12/772,829 Abandoned US20100317540A1 (en) | 1990-07-10 | 2010-05-03 | Methods for producing members of specific binding pairs |
US13/165,300 Abandoned US20120129710A1 (en) | 1990-07-10 | 2011-06-21 | Methods for producing members of specific binding pairs |
Family Applications Before (3)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US07/971,857 Expired - Lifetime US5969108A (en) | 1990-07-10 | 1991-07-10 | Methods for producing members of specific binding pairs |
US09/416,902 Expired - Fee Related US7635666B1 (en) | 1990-07-10 | 1999-10-13 | Methods for producing members of specific binding pairs |
US09/417,478 Expired - Fee Related US7723270B1 (en) | 1990-07-10 | 1999-10-13 | Methods for producing members of specific binding pairs |
Family Applications After (3)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US11/555,464 Abandoned US20090155810A1 (en) | 1990-07-10 | 2006-11-01 | Methods for producing members of specific binding pairs |
US12/772,829 Abandoned US20100317540A1 (en) | 1990-07-10 | 2010-05-03 | Methods for producing members of specific binding pairs |
US13/165,300 Abandoned US20120129710A1 (en) | 1990-07-10 | 2011-06-21 | Methods for producing members of specific binding pairs |
Country Status (16)
Country | Link |
---|---|
US (7) | US5969108A (en) |
EP (7) | EP0589877B2 (en) |
JP (1) | JP3176917B2 (en) |
KR (1) | KR100222326B1 (en) |
AT (6) | ATE145237T1 (en) |
AU (1) | AU664155B2 (en) |
CA (1) | CA2086936C (en) |
DE (7) | DE69132920C5 (en) |
DK (5) | DK0774511T3 (en) |
ES (5) | ES2096655T5 (en) |
GB (2) | GB9015198D0 (en) |
GR (1) | GR3022126T3 (en) |
HK (1) | HK1131637A1 (en) |
LU (1) | LU91623I2 (en) |
NL (1) | NL300423I1 (en) |
WO (1) | WO1992001047A1 (en) |
Cited By (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2009102927A1 (en) * | 2008-02-13 | 2009-08-20 | Dyax Corp. | Improved methods for producing specific binding pairs |
US11793843B2 (en) | 2019-01-10 | 2023-10-24 | Janssen Biotech, Inc. | Prostate neoantigens and their uses |
Families Citing this family (2652)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
US5534617A (en) * | 1988-10-28 | 1996-07-09 | Genentech, Inc. | Human growth hormone variants having greater affinity for human growth hormone receptor at site 1 |
US5688666A (en) * | 1988-10-28 | 1997-11-18 | Genentech, Inc. | Growth hormone variants with altered binding properties |
KR0184860B1 (en) * | 1988-11-11 | 1999-04-01 | 메디칼 리써어치 카운실 | Single domain ligands receptors comprising said ligands methods for their production and use of said ligands |
US7413537B2 (en) | 1989-09-01 | 2008-08-19 | Dyax Corp. | Directed evolution of disulfide-bonded micro-proteins |
US5427908A (en) * | 1990-05-01 | 1995-06-27 | Affymax Technologies N.V. | Recombinant library screening methods |
US5723286A (en) * | 1990-06-20 | 1998-03-03 | Affymax Technologies N.V. | Peptide library and screening systems |
GB9015198D0 (en) | 1990-07-10 | 1990-08-29 | Brien Caroline J O | Binding substance |
US6916605B1 (en) | 1990-07-10 | 2005-07-12 | Medical Research Council | Methods for producing members of specific binding pairs |
US7063943B1 (en) | 1990-07-10 | 2006-06-20 | Cambridge Antibody Technology | Methods for producing members of specific binding pairs |
GB9206318D0 (en) * | 1992-03-24 | 1992-05-06 | Cambridge Antibody Tech | Binding substances |
DK0585287T3 (en) * | 1990-07-10 | 2000-04-17 | Cambridge Antibody Tech | Process for producing specific binding pair elements |
US5770429A (en) * | 1990-08-29 | 1998-06-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
US7084260B1 (en) | 1996-10-10 | 2006-08-01 | Genpharm International, Inc. | High affinity human antibodies and human antibodies against human antigens |
US7041871B1 (en) | 1995-10-10 | 2006-05-09 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
US6893845B1 (en) | 1990-09-28 | 2005-05-17 | Applied Molecular Evolution, Inc. | Surface expression libraries of heteromeric receptors |
WO1992006191A1 (en) * | 1990-09-28 | 1992-04-16 | Protein Engineering Corporation | Proteinaceous anti-dental plaque agents |
ES2113940T3 (en) * | 1990-12-03 | 1998-05-16 | Genentech Inc | ENRICHMENT METHOD FOR PROTEIN VARIANTS WITH ALTERED UNION PROPERTIES. |
DE69233697T2 (en) | 1991-03-01 | 2008-01-24 | Dyax Corp., Cambridge | Process for the development of binding microproteins |
DE69233750D1 (en) | 1991-04-10 | 2009-01-02 | Scripps Research Inst | Libraries of heterodimeric receptors using phagemids |
US6225447B1 (en) | 1991-05-15 | 2001-05-01 | Cambridge Antibody Technology Ltd. | Methods for producing members of specific binding pairs |
US6492160B1 (en) | 1991-05-15 | 2002-12-10 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
DE69230142T2 (en) | 1991-05-15 | 2000-03-09 | Cambridge Antibody Tech | METHOD FOR PRODUCING SPECIFIC BINDING PAIRS |
WO1994004679A1 (en) * | 1991-06-14 | 1994-03-03 | Genentech, Inc. | Method for making humanized antibodies |
US6800738B1 (en) | 1991-06-14 | 2004-10-05 | Genentech, Inc. | Method for making humanized antibodies |
ES2206447T3 (en) | 1991-06-14 | 2004-05-16 | Genentech, Inc. | HUMANIZED ANTIBODY FOR HEREGULINE. |
DE4122599C2 (en) | 1991-07-08 | 1993-11-11 | Deutsches Krebsforsch | Phagemid for screening antibodies |
DK0605522T3 (en) * | 1991-09-23 | 2000-01-17 | Medical Res Council | Process for producing humanized antibodies |
ES2136092T3 (en) * | 1991-09-23 | 1999-11-16 | Medical Res Council | PROCEDURES FOR THE PRODUCTION OF HUMANIZED ANTIBODIES. |
US5733731A (en) * | 1991-10-16 | 1998-03-31 | Affymax Technologies N.V. | Peptide library and screening method |
US5270170A (en) * | 1991-10-16 | 1993-12-14 | Affymax Technologies N.V. | Peptide library and screening method |
DK1024191T3 (en) * | 1991-12-02 | 2008-12-08 | Medical Res Council | Preparation of autoantibodies displayed on phage surfaces from antibody segment libraries |
EP1696031B1 (en) | 1991-12-02 | 2010-04-07 | MedImmune Limited | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
US5872215A (en) * | 1991-12-02 | 1999-02-16 | Medical Research Council | Specific binding members, materials and methods |
DE69233408T2 (en) * | 1991-12-02 | 2005-09-22 | Cambridge Antibody Technology Ltd., Melbourn | Production of Antibodies on Phage Surfaces Starting from Antibody Segment Libraries. |
CA2131151A1 (en) * | 1992-03-24 | 1994-09-30 | Kevin S. Johnson | Methods for producing members of specific binding pairs |
US6765087B1 (en) | 1992-08-21 | 2004-07-20 | Vrije Universiteit Brussel | Immunoglobulins devoid of light chains |
ES2162823T5 (en) | 1992-08-21 | 2010-08-09 | Vrije Universiteit Brussel | IMMUNOGLOBULINS DESPROVISTAS OF LIGHT CHAINS. |
DE69331278T2 (en) * | 1992-09-04 | 2002-07-18 | Scripps Research Inst | PHAGEMIDES CO-EXPRESSING A SURFACE RECEPTOR AND A HETEROLOGICAL SURFACE PROTEIN |
US5844094A (en) * | 1992-09-25 | 1998-12-01 | Commonwealth Scientific And Industrial Research Organization | Target binding polypeptide |
US6936464B1 (en) | 1992-10-02 | 2005-08-30 | Cancer Research Technology Limited | Immune responses to fusion proteins |
GB9220808D0 (en) * | 1992-10-02 | 1992-11-18 | Medical Res Council | Antibody genes |
GB9225453D0 (en) | 1992-12-04 | 1993-01-27 | Medical Res Council | Binding proteins |
JP3720353B2 (en) * | 1992-12-04 | 2005-11-24 | メディカル リサーチ カウンシル | Multivalent and multispecific binding proteins, their production and use |
AU6235294A (en) | 1993-02-02 | 1994-08-29 | Scripps Research Institute, The | Methods for producing polypeptide binding sites |
DE614989T1 (en) * | 1993-02-17 | 1995-09-28 | Morphosys Proteinoptimierung | Method for in vivo selection of ligand binding proteins. |
EP0614989A1 (en) * | 1993-02-17 | 1994-09-14 | MorphoSys AG | A method for in vivo selection of ligand-binding proteins |
US6027884A (en) * | 1993-06-17 | 2000-02-22 | The Research Foundation Of The State University Of New York | Thermodynamics, design, and use of nucleic acid sequences |
AU680685B2 (en) | 1993-09-22 | 1997-08-07 | Medical Research Council | Retargeting antibodies |
DK145493D0 (en) * | 1993-12-23 | 1993-12-23 | Dako As | ANTIBODY |
US20060078561A1 (en) * | 1994-01-31 | 2006-04-13 | The Trustees Of Boston University | Polyclonal antibody libraries |
DK0744958T3 (en) | 1994-01-31 | 2003-10-20 | Univ Boston | Polyclonal antibody libraries |
US5516637A (en) * | 1994-06-10 | 1996-05-14 | Dade International Inc. | Method involving display of protein binding pairs on the surface of bacterial pili and bacteriophage |
US6576236B1 (en) | 1994-07-01 | 2003-06-10 | Dana Farber Cancer Institute | Methods for stimulating T cell responses by manipulating a common cytokine receptor γ chain |
US6010861A (en) * | 1994-08-03 | 2000-01-04 | Dgi Biotechnologies, Llc | Target specific screens and their use for discovering small organic molecular pharmacophores |
US7597886B2 (en) * | 1994-11-07 | 2009-10-06 | Human Genome Sciences, Inc. | Tumor necrosis factor-gamma |
US7820798B2 (en) * | 1994-11-07 | 2010-10-26 | Human Genome Sciences, Inc. | Tumor necrosis factor-gamma |
AUPO591797A0 (en) | 1997-03-27 | 1997-04-24 | Commonwealth Scientific And Industrial Research Organisation | High avidity polyvalent and polyspecific reagents |
US7060808B1 (en) * | 1995-06-07 | 2006-06-13 | Imclone Systems Incorporated | Humanized anti-EGF receptor monoclonal antibody |
EP0859841B1 (en) * | 1995-08-18 | 2002-06-19 | MorphoSys AG | Protein/(poly)peptide libraries |
US7264963B1 (en) | 1995-08-18 | 2007-09-04 | Morphosys Ag | Protein(poly)peptide libraries |
GB9518731D0 (en) | 1995-09-13 | 1995-11-15 | Innes John Centre | Flowering genes |
ATE455171T1 (en) * | 1995-09-21 | 2010-01-15 | Genentech Inc | VARIANTS OF HUMAN GROWTH HORMONE |
US7368111B2 (en) | 1995-10-06 | 2008-05-06 | Cambridge Antibody Technology Limited | Human antibodies specific for TGFβ2 |
US6090382A (en) | 1996-02-09 | 2000-07-18 | Basf Aktiengesellschaft | Human antibodies that bind human TNFα |
US6537776B1 (en) | 1999-06-14 | 2003-03-25 | Diversa Corporation | Synthetic ligation reassembly in directed evolution |
US7888466B2 (en) | 1996-01-11 | 2011-02-15 | Human Genome Sciences, Inc. | Human G-protein chemokine receptor HSATU68 |
SE506771C2 (en) * | 1996-02-06 | 1998-02-09 | Gotpat 105 Ab | Fusion protein, bacteriophage expressing the protein, their use and hybridoma cells and monoclonals produced by the cells |
US6046310A (en) * | 1996-03-13 | 2000-04-04 | Protein Design Labs., Inc. | FAS ligand fusion proteins and their uses |
GB9712818D0 (en) | 1996-07-08 | 1997-08-20 | Cambridge Antibody Tech | Labelling and selection of specific binding molecules |
KR20000048820A (en) | 1996-10-01 | 2000-07-25 | 게론 코포레이션 | Telomerase reverse transcriptase |
US7883872B2 (en) * | 1996-10-10 | 2011-02-08 | Dyadic International (Usa), Inc. | Construction of highly efficient cellulase compositions for enzymatic hydrolysis of cellulose |
US5811381A (en) * | 1996-10-10 | 1998-09-22 | Mark A. Emalfarb | Cellulase compositions and methods of use |
GB9701425D0 (en) | 1997-01-24 | 1997-03-12 | Bioinvent Int Ab | A method for in vitro molecular evolution of protein function |
US6497874B1 (en) * | 1997-02-05 | 2002-12-24 | Maardh Sven | Recombinant phages |
DE69842225D1 (en) | 1997-04-16 | 2011-05-26 | Millennium Pharm Inc | A composition comprising an antibody that selectively binds to a cysteine-rich secreted protein (CRSP) |
US6342369B1 (en) | 1997-05-15 | 2002-01-29 | Genentech, Inc. | Apo-2-receptor |
US20040241759A1 (en) * | 1997-06-16 | 2004-12-02 | Eileen Tozer | High throughput screening of libraries |
CA2297070A1 (en) * | 1997-08-01 | 1999-02-11 | Morphosys Ag | Novel method and phage for the identification of nucleic acid sequences encoding members of a multimeric (poly)peptide complex |
GB9717192D0 (en) | 1997-08-13 | 1997-10-22 | Innes John Centre Innov Ltd | Genetic control of plant growth and development |
US6342220B1 (en) | 1997-08-25 | 2002-01-29 | Genentech, Inc. | Agonist antibodies |
US6562599B1 (en) | 1997-09-02 | 2003-05-13 | Sumitomo Pharmaceuticals Company, Limited | Single-stranded antibody against hepatitis B virus core protein, gene thereof, and therapeutic agent for hepatitis B containing these |
GB9718455D0 (en) | 1997-09-02 | 1997-11-05 | Mcgregor Duncan P | Chimeric binding peptide library screening method |
AU9395398A (en) * | 1997-09-19 | 1999-04-12 | Chiron Corporation | Subtractive protein screening for gene identification |
GB9722131D0 (en) | 1997-10-20 | 1997-12-17 | Medical Res Council | Method |
WO1999020752A1 (en) | 1997-10-21 | 1999-04-29 | The University Court Of The University Of Glasgow | JMY, A CO-ACTIVATOR FOR p300/CBP, NUCLEIC ACID ENCODING JMY AND USES THEREOF |
US6355244B1 (en) | 1997-11-17 | 2002-03-12 | University Of Kentucky Research Foundation | Methods and compositions for the treatment of psoriasis |
US7964192B1 (en) | 1997-12-02 | 2011-06-21 | Janssen Alzheimer Immunotherapy | Prevention and treatment of amyloidgenic disease |
US20080050367A1 (en) | 1998-04-07 | 2008-02-28 | Guriq Basi | Humanized antibodies that recognize beta amyloid peptide |
TWI239847B (en) | 1997-12-02 | 2005-09-21 | Elan Pharm Inc | N-terminal fragment of Abeta peptide and an adjuvant for preventing and treating amyloidogenic disease |
US7179892B2 (en) | 2000-12-06 | 2007-02-20 | Neuralab Limited | Humanized antibodies that recognize beta amyloid peptide |
US6759243B2 (en) | 1998-01-20 | 2004-07-06 | Board Of Trustees Of The University Of Illinois | High affinity TCR proteins and methods |
JP2002502977A (en) | 1998-02-04 | 2002-01-29 | インビトロジェン コーポレイション | Microarrays and their uses |
EP1982990A1 (en) | 1998-03-19 | 2008-10-22 | Human Genome Sciences, Inc. | Cytokine receptor common gamma chain like |
US20030224001A1 (en) * | 1998-03-19 | 2003-12-04 | Goldstein Neil I. | Antibody and antibody fragments for inhibiting the growth of tumors |
EP0947582A1 (en) * | 1998-03-31 | 1999-10-06 | Innogenetics N.V. | A polypeptide structure for use as a scaffold |
US7056517B2 (en) | 1998-04-13 | 2006-06-06 | The Forsyth Institute | Glucosyltransferase immunogens |
US7163682B2 (en) | 1998-04-13 | 2007-01-16 | The Forsyth Institute | Glucan binding protein and glucosyltransferase immunogens |
GB2379933B (en) * | 1998-05-13 | 2003-07-09 | Domantis Ltd | Selection system for phagemids using proteolytically sensitive helper phage |
PT1078051E (en) * | 1998-05-13 | 2008-03-17 | Domantis Ltd | Phage-display system for the selection of correctly folded proteins |
ZA200007412B (en) * | 1998-05-15 | 2002-03-12 | Imclone Systems Inc | Treatment of human tumors with radiation and inhibitors of growth factor receptor tyrosine kinases. |
GB9810756D0 (en) | 1998-05-19 | 1998-07-15 | Angeletti P Ist Richerche Bio | Mimotopes of hypervariable region 1 of the e2 glycoprotein of hcv and uses thereof |
PT1086138E (en) | 1998-06-12 | 2010-01-04 | Genentech Inc | Monoclonal antibodies, cross-reactive antibodies and method for producing the same |
US7153655B2 (en) * | 1998-06-16 | 2006-12-26 | Alligator Bioscience Ab | Method for in vitro molecular evolution of protein function involving the use of exonuclease enzyme and two populations of parent polynucleotide sequence |
US6846655B1 (en) | 1998-06-29 | 2005-01-25 | Phylos, Inc. | Methods for generating highly diverse libraries |
US6323325B1 (en) | 1998-07-23 | 2001-11-27 | The United States Of America As Represented By The Department Of Health And Human Services | Agents that bind to and inhibit human cytochrome P450 2A6 |
US6335428B1 (en) * | 1998-07-23 | 2002-01-01 | The United States Of America As Represented By The Department Of Health And Human Services | Agents that bind to and inhibit human cytochrome P450 1A2 |
AU5122499A (en) | 1998-07-27 | 2000-02-21 | Genentech Inc. | Improved transformation efficiency in phage display through modification of a coat protein |
DK1117808T3 (en) * | 1998-10-06 | 2005-04-25 | Mark Aaron Emalfarb | Transformational system before comparing the area of filamentous fungal hosts: In the chrysosporium |
US6420110B1 (en) | 1998-10-19 | 2002-07-16 | Gpc Biotech, Inc. | Methods and reagents for isolating biologically active peptides |
US6667176B1 (en) | 2000-01-11 | 2003-12-23 | Geron Corporation | cDNA libraries reflecting gene expression during growth and differentiation of human pluripotent stem cells |
US7112661B1 (en) | 1998-10-30 | 2006-09-26 | The Research Foundation Of State University Of New York | Variable heavy chain and variable light chain regions of antibodies to human platelet glycoprotein Ib alpha |
US6395511B1 (en) | 1998-11-27 | 2002-05-28 | Darwin Discovery, Ltd. | Nucleic acids encoding a novel family of TGF-β binding proteins from humans |
CA2363779A1 (en) | 1999-02-26 | 2000-08-31 | Human Genome Sciences, Inc. | Human endokine alpha and methods of use |
EP2301947A3 (en) | 1999-02-26 | 2011-11-23 | Millennium Pharmaceuticals, Inc. | Secreted proteins and uses thereof |
US6914128B1 (en) | 1999-03-25 | 2005-07-05 | Abbott Gmbh & Co. Kg | Human antibodies that bind human IL-12 and methods for producing |
US7883704B2 (en) | 1999-03-25 | 2011-02-08 | Abbott Gmbh & Co. Kg | Methods for inhibiting the activity of the P40 subunit of human IL-12 |
KR101222450B1 (en) | 1999-03-25 | 2013-01-16 | 애보트 게엠베하 운트 콤파니 카게 | Human antibodies that bind human IL-12 and methods for producing |
DE19915057A1 (en) | 1999-04-01 | 2000-10-19 | Forschungszentrum Borstel | Monoclonal antibodies to the human Mcm3 protein, process for their preparation and their use |
GB9908195D0 (en) | 1999-04-09 | 1999-06-02 | Microbiological Res Authority | Treatment of intracellular infection |
EP1169473B1 (en) | 1999-04-14 | 2006-11-22 | THE GOVERNMENT OF THE UNITED STATES OF AMERICA, as represented by THE SECRETARY, DEPARTMENT OF HEALTH AND HUMAN SERVICES | High sensitivity phage display biomolecule detection |
US6492497B1 (en) | 1999-04-30 | 2002-12-10 | Cambridge Antibody Technology Limited | Specific binding members for TGFbeta1 |
BR0010524A (en) * | 1999-05-14 | 2002-05-28 | Imclone Systems Inc | Treatment of refractory human tumors with epidermal growth factor receptor antagonists |
AU777005B2 (en) | 1999-05-15 | 2004-09-30 | University Of California, San Diego | Protein A based binding domains with desirable activities |
US7163686B1 (en) | 1999-05-15 | 2007-01-16 | The Regents Of The University Of California | Protein A based binding domains with desirable activities |
US20020102613A1 (en) * | 1999-05-18 | 2002-08-01 | Hoogenboom Hendricus Renerus Jacobus Mattheus | Novel Fab fragment libraries and methods for their use |
DK2067788T3 (en) * | 1999-05-18 | 2015-10-19 | Dyax Corp | Fab fragment libraries and methods for using them |
UA81216C2 (en) | 1999-06-01 | 2007-12-25 | Prevention and treatment of amyloid disease | |
US6262265B1 (en) | 1999-06-18 | 2001-07-17 | Microgenics Corporation | Non-hydrolyzable analogs of heroin metabolites suitable for use in immunoassay |
US7291714B1 (en) | 1999-06-30 | 2007-11-06 | Millennium Pharmaceuticals, Inc. | Glycoprotein VI and uses thereof |
US20040001826A1 (en) | 1999-06-30 | 2004-01-01 | Millennium Pharmaceuticals, Inc. | Glycoprotein VI and uses thereof |
EP1990409A3 (en) | 1999-07-20 | 2011-05-18 | MorphoSys AG | Bacteriophage |
US6808710B1 (en) | 1999-08-23 | 2004-10-26 | Genetics Institute, Inc. | Downmodulating an immune response with multivalent antibodies to PD-1 |
TWI248365B (en) | 1999-08-23 | 2006-02-01 | Chugai Pharmaceutical Co Ltd | HM1.24 antigen expression potentiators |
US7297478B1 (en) | 2000-09-22 | 2007-11-20 | Large Scale Biology Corporation | Creation of variable length and sequence linker regions for dual-domain or multi-domain molecules |
AU783776B2 (en) | 1999-10-12 | 2005-12-01 | Chemocentryx, Inc. | Chemokine receptor |
US20060073509A1 (en) * | 1999-11-18 | 2006-04-06 | Michael Kilpatrick | Method for detecting and quantitating multiple subcellular components |
DE50014247D1 (en) * | 1999-11-26 | 2007-05-24 | Basf Plant Science Gmbh | PROCESS FOR THE MUTAGENESIS OF NUCLEOTIDE SEQUENCES FROM PLANTS, ALGAE, OR MUSHROOMS |
PT1234031T (en) | 1999-11-30 | 2017-06-26 | Mayo Foundation | B7-h1, a novel immunoregulatory molecule |
EP1254169B1 (en) | 1999-12-30 | 2007-05-09 | President And Fellows of Harvard College | Methods relating to modulation of th2 cell subset activity by modulation of xbp-1 activity |
AU2002219944B2 (en) | 2000-11-28 | 2008-02-21 | Medimmune, Llc | Methods of administering/dosing anti-RSV antibodies for prophylaxis and treatment |
TWI373343B (en) | 2000-02-10 | 2012-10-01 | Abbott Gmbh & Co Kg | Antibodies that bind human interleukin-18 and methods of making and using |
AU2001234125A1 (en) * | 2000-02-22 | 2001-09-03 | Medical And Biological Laboratories Co., Ltd. | Antibody library |
EP1259601A2 (en) * | 2000-02-22 | 2002-11-27 | Ahuva Nissim | Chimeric and tcr phage display libraries, chimeric and tcr reagents and methods of use thereof |
GB2360282A (en) * | 2000-03-17 | 2001-09-19 | Bioinvent Int Ab | Making and using micro-arrays of biological materials |
EP1276849A4 (en) | 2000-04-12 | 2004-06-09 | Human Genome Sciences Inc | Albumin fusion proteins |
AU2001255436A1 (en) * | 2000-04-17 | 2001-10-30 | Transtech Pharma | Protein expression system arrays and use in biological screening |
US8288322B2 (en) * | 2000-04-17 | 2012-10-16 | Dyax Corp. | Methods of constructing libraries comprising displayed and/or expressed members of a diverse family of peptides, polypeptides or proteins and the novel libraries |
JP5149476B2 (en) * | 2000-04-17 | 2013-02-20 | ダイアックス コーポレイション | How to construct a display library of genetic packages as members of a diverse family of peptides |
US7495070B2 (en) * | 2000-04-24 | 2009-02-24 | Yale University | Protein binding miniature proteins |
JP2004528802A (en) * | 2000-04-24 | 2004-09-24 | イエール・ユニバーシテイ | Small proteins that bind DNA and proteins |
US6458589B1 (en) | 2000-04-27 | 2002-10-01 | Geron Corporation | Hepatocyte lineage cells derived from pluripotent stem cells |
US7030219B2 (en) | 2000-04-28 | 2006-04-18 | Johns Hopkins University | B7-DC, Dendritic cell co-stimulatory molecules |
ES2316446T3 (en) | 2000-04-29 | 2009-04-16 | University Of Iowa Research Foundation | DIAGNOSIS AND THERAPEUTICS FOR DISORDERS RELATED TO MACULAR DEGENERATION. |
EP1714661A3 (en) | 2000-05-19 | 2012-03-14 | The Center for Blood Research, INC. | Methods for diagnosing and treating hemostatic disorders by modulating p-selectin activity |
US20030031675A1 (en) | 2000-06-06 | 2003-02-13 | Mikesell Glen E. | B7-related nucleic acids and polypeptides useful for immunomodulation |
DE60141463D1 (en) | 2000-06-08 | 2010-04-15 | Immune Disease Inst Inc | METHODS AND COMPOUNDS FOR INHIBITING IMMUNOGLOBULIN-MEDIATED REPERFUSION INJURIES |
WO2001096528A2 (en) | 2000-06-15 | 2001-12-20 | Human Genome Sciences, Inc. | Human tumor necrosis factor delta and epsilon |
PT2275449T (en) | 2000-06-16 | 2016-12-27 | Human Genome Sciences Inc | Antibodies that immunospecifically bind to blys |
US20020115068A1 (en) * | 2000-06-23 | 2002-08-22 | Ian Tomlinson | Matrix screening method |
US20020055110A1 (en) * | 2000-06-23 | 2002-05-09 | Ian Tomlinson | Matrix screening method |
WO2002000730A2 (en) | 2000-06-28 | 2002-01-03 | Genetics Institute, Llc. | Pd-l2 molecules: novel pd-1 ligands and uses therefor |
DE60137421D1 (en) | 2000-06-29 | 2009-03-05 | Abbott Lab | ANTIBODIES WITH TWO SPECIFICITIES AND METHOD FOR THE PRODUCTION AND USE THEREOF |
AU2001277648A1 (en) | 2000-07-14 | 2002-04-15 | Cropdesign N.V. | Plant cyclin-dependent kinase inhibitors |
US20020019004A1 (en) * | 2000-08-03 | 2002-02-14 | Albert Orfao | Method for isolating molecules, cells and other particles which are specifically bound to a large particle |
JP2004527456A (en) * | 2000-08-09 | 2004-09-09 | イムクローン システムズ インコーポレイティド | Treatment of hyperproliferative diseases with EGF receptor antagonists |
JP5113314B2 (en) | 2000-09-01 | 2013-01-09 | ザ センター フォー ブラッド リサーチ インク | Modified polypeptide stabilized in desired conformation and method for producing the polypeptide |
GB0022748D0 (en) | 2000-09-15 | 2000-11-01 | Allied Therapeutics Ltd | Reducing the content of cells in a biological sample |
GB0022978D0 (en) | 2000-09-19 | 2000-11-01 | Oxford Glycosciences Uk Ltd | Detection of peptides |
US6673580B2 (en) * | 2000-10-27 | 2004-01-06 | Genentech, Inc. | Identification and modification of immunodominant epitopes in polypeptides |
AU2002241556B2 (en) | 2000-11-01 | 2007-07-19 | Elusys Therapeutics, Inc. | Method of producing bispecific molecules by protein trans-splicing |
EP1355939A2 (en) | 2000-11-03 | 2003-10-29 | Pestka Biomedical Laboratories, Inc. | Interferons, uses and compositions related thereto |
BR0115728A (en) | 2000-11-28 | 2003-09-23 | Wyeth Corp | Analysis of expression of kiaa nucleic acids and polypeptides useful in the diagnosis and treatment of prostate cancer. |
NZ526708A (en) | 2000-11-28 | 2005-07-29 | Wyeth Corp | Expression analysis of FKBP nucleic acids and polypeptides useful in the diagnosis and treatment of prostate cancer |
US7396917B2 (en) * | 2000-12-05 | 2008-07-08 | Alexion Pharmaceuticals, Inc. | Rationally designed antibodies |
ATE544785T1 (en) | 2000-12-05 | 2012-02-15 | Alexion Pharma Inc | RATIONALLY DESIGNED ANTIBODIES |
US20040253242A1 (en) * | 2000-12-05 | 2004-12-16 | Bowdish Katherine S. | Rationally designed antibodies |
PE20020574A1 (en) | 2000-12-06 | 2002-07-02 | Wyeth Corp | HUMANIZED ANTIBODIES THAT RECOGNIZE THE AMYLOID PEPTIDE BETA |
US20020165149A1 (en) * | 2000-12-08 | 2002-11-07 | Kranz David M. | Mutated class II major histocompatibility proteins |
US6958213B2 (en) | 2000-12-12 | 2005-10-25 | Alligator Bioscience Ab | Method for in vitro molecular evolution of protein function |
EP2341060B1 (en) | 2000-12-12 | 2019-02-20 | MedImmune, LLC | Molecules with extended half-lives, compositions and uses thereof |
JP4860098B2 (en) | 2000-12-18 | 2012-01-25 | ダイアックス、コープ | Library focused on genetic packaging |
ES2390425T3 (en) | 2000-12-22 | 2012-11-12 | MAX-PLANCK-Gesellschaft zur Förderung der Wissenschaften e.V. | Use of repulsive targeting molecules (RGM) and their modulators |
US20020086292A1 (en) | 2000-12-22 | 2002-07-04 | Shigeaki Harayama | Synthesis of hybrid polynucleotide molecules using single-stranded polynucleotide molecules |
US7132510B2 (en) | 2000-12-29 | 2006-11-07 | Bio-Technology General (Israel) Ltd. | Specific human antibodies for selective cancer therapy |
AR032028A1 (en) | 2001-01-05 | 2003-10-22 | Pfizer | ANTIBODIES AGAINST THE RECEIVER OF THE SIMILAR TO INSULIN GROWTH FACTOR |
CA2444661A1 (en) | 2001-01-31 | 2002-08-08 | Idec Pharmaceutical Corporation | Use of cd23 antagonists for the treatment of neoplastic disorders |
AU2002251913A1 (en) * | 2001-02-02 | 2002-08-19 | Millennium Pharmaceuticals, Inc. | Hybrid antibodies and uses thereof |
JP3986439B2 (en) | 2001-02-07 | 2007-10-03 | 中外製薬株式会社 | Hematopoietic tumor therapeutic agent |
ATE337395T1 (en) * | 2001-02-07 | 2006-09-15 | Wilex Ag | HYBRIDOMA CELL LINE G250 AND THE USE THEREOF FOR PRODUCING MONOCLONAL ANTIBODIES |
JP2005503116A (en) | 2001-02-09 | 2005-02-03 | ヒューマン ジノーム サイエンシーズ, インコーポレイテッド | Human G protein chemokine receptor (CCR5) HDGNR10 |
EP2123749A3 (en) | 2001-02-23 | 2010-02-24 | DSM IP Assets B.V. | Novel genes encoding novel proteolytic enzymes |
ES2360205T3 (en) | 2001-03-02 | 2011-06-01 | Agennix Ag | THREE HYBRID TEST SYSTEM. |
AU2002250236A1 (en) * | 2001-03-02 | 2002-09-19 | Medimmune, Inc. | Cd2 antagonists for treatment of autoimmune or inflammatory disease |
US20080008704A1 (en) * | 2001-03-16 | 2008-01-10 | Mark Rubin | Methods of treating colorectal cancer with anti-epidermal growth factor antibodies |
US20090081199A1 (en) * | 2001-03-20 | 2009-03-26 | Bioxell S.P.A. | Novel receptor trem (triggering receptor expressed on myeloid cells) and uses thereof |
US8981061B2 (en) | 2001-03-20 | 2015-03-17 | Novo Nordisk A/S | Receptor TREM (triggering receptor expressed on myeloid cells) and uses thereof |
US8231878B2 (en) | 2001-03-20 | 2012-07-31 | Cosmo Research & Development S.P.A. | Receptor trem (triggering receptor expressed on myeloid cells) and uses thereof |
CA2342376C (en) * | 2001-03-20 | 2013-11-12 | Marco Colonna | A receptor trem (triggering receptor expressed on myeloid cells) and uses thereof |
WO2002076196A1 (en) | 2001-03-22 | 2002-10-03 | Abbott Gmbh & Co. Kg | Transgenic animals expressing antibodies specific for genes of interest and uses thereof |
WO2002079499A1 (en) | 2001-04-02 | 2002-10-10 | Wyeth | Pd-1, a receptor for b7-4, and uses therefor |
US20030003097A1 (en) * | 2001-04-02 | 2003-01-02 | Idec Pharmaceutical Corporation | Recombinant antibodies coexpressed with GnTIII |
UA80091C2 (en) | 2001-04-02 | 2007-08-27 | Chugai Pharmaceutical Co Ltd | Remedies for infant chronic arthritis-relating diseases and still's disease which contain an interleukin-6 (il-6) antagonist |
EP1249499A1 (en) * | 2001-04-10 | 2002-10-16 | Fraunhofer-Gesellschaft zur Förderung der angewandten Forschung e.V. | Method and device for the determination and selection of molecule-molecule interactions |
DE60236646D1 (en) | 2001-04-13 | 2010-07-22 | Human Genome Sciences Inc | Anti-VEGF-2 antibodies |
MXPA03009415A (en) | 2001-04-16 | 2004-01-29 | Wyeth Corp | Novel streptococcus pneumoniae open reading frames encoding polypeptide antigens and uses thereof. |
US20100056762A1 (en) | 2001-05-11 | 2010-03-04 | Old Lloyd J | Specific binding proteins and uses thereof |
ES2552281T3 (en) | 2001-05-11 | 2015-11-26 | Ludwig Institute For Cancer Research Ltd. | Specific binding proteins and uses thereof |
US20110313230A1 (en) | 2001-05-11 | 2011-12-22 | Terrance Grant Johns | Specific binding proteins and uses thereof |
EP1990057A1 (en) | 2001-05-22 | 2008-11-12 | Merck & Co., Inc. | Beta-secretase substrates and uses thereof |
US20020197253A1 (en) * | 2001-05-22 | 2002-12-26 | Cheek Dennis J. | Compositions and methods for promoting or inhibiting NDPK |
JP2004535400A (en) * | 2001-05-22 | 2004-11-25 | デューク ユニバーシティ | Compositions and methods for inhibiting metastasis |
WO2002097033A2 (en) | 2001-05-25 | 2002-12-05 | Human Genome Sciences, Inc. | Antibodies that immunospecifically bind to trail receptors |
US6441163B1 (en) | 2001-05-31 | 2002-08-27 | Immunogen, Inc. | Methods for preparation of cytotoxic conjugates of maytansinoids and cell binding agents |
US7129261B2 (en) * | 2001-05-31 | 2006-10-31 | Medarex, Inc. | Cytotoxic agents |
US20060239533A1 (en) * | 2001-06-04 | 2006-10-26 | Triantafyllos Tafas | Method for detecting infectious agents using computer controlled automated image analysis |
CA2868614A1 (en) | 2001-06-08 | 2002-12-08 | Abbott Laboratories (Bermuda) Ltd. | Methods of administering anti-tnf.alpha. antibodies |
EP2270186A3 (en) | 2001-06-22 | 2012-04-18 | Pioneer Hi-Bred International, Inc. | Defensin polynucleotides and methods of use |
GB0115841D0 (en) | 2001-06-28 | 2001-08-22 | Medical Res Council | Ligand |
US6867189B2 (en) | 2001-07-26 | 2005-03-15 | Genset S.A. | Use of adipsin/complement factor D in the treatment of metabolic related disorders |
US6833441B2 (en) | 2001-08-01 | 2004-12-21 | Abmaxis, Inc. | Compositions and methods for generating chimeric heteromultimers |
AU2002355955A1 (en) * | 2001-08-13 | 2003-03-03 | University Of Southern California | Interleukin-2 mutants with reduced toxicity |
US20040142325A1 (en) | 2001-09-14 | 2004-07-22 | Liat Mintz | Methods and systems for annotating biomolecular sequences |
US20050130124A1 (en) * | 2001-10-05 | 2005-06-16 | Wiersma Erik J. | Phagemid display system |
AU2002340167A1 (en) | 2001-10-11 | 2003-06-17 | Protein Design Labs Inc. | Anti-hla-dr antibodies and the methods of using thereof |
WO2003035839A2 (en) * | 2001-10-24 | 2003-05-01 | Dgi Biotechnologies, Inc. | Target specific screening andits use for identifying target binders |
EP1440083B1 (en) | 2001-10-25 | 2013-01-02 | Medical Research Council | Molecules |
US7175983B2 (en) | 2001-11-02 | 2007-02-13 | Abmaxis, Inc. | Adapter-directed display systems |
AR039067A1 (en) | 2001-11-09 | 2005-02-09 | Pfizer Prod Inc | ANTIBODIES FOR CD40 |
ATE550352T1 (en) | 2001-12-03 | 2012-04-15 | Alexion Pharma Inc | METHOD FOR PRODUCING HYBRID ANTIBODIES |
ES2337989T3 (en) | 2001-12-18 | 2010-05-03 | Endocube Sas | NEW PROTEINS ASSOCIATED WITH THE DEATH OF THE THAP FAMILY AND RELATED PAR4 ROUTES INVOLVED IN THE CONTROL OF APOPTOSIS. |
US7858297B2 (en) | 2001-12-18 | 2010-12-28 | Centre National De La Recherche Scientifique Cnrs | Chemokine-binding protein and methods of use |
EP1463807A4 (en) | 2001-12-19 | 2006-04-12 | Bristol Myers Squibb Co | Pichia pastoris formate dehydrogenase and uses therefor |
GB0130543D0 (en) | 2001-12-20 | 2002-02-06 | Univ Cambridge Tech | Human antibodies and their use |
US20050037358A1 (en) * | 2001-12-21 | 2005-02-17 | Serge Muyldermans | Method for cloning of variable domain sequences |
US20080194481A1 (en) | 2001-12-21 | 2008-08-14 | Human Genome Sciences, Inc. | Albumin Fusion Proteins |
EP2277889B1 (en) | 2001-12-21 | 2014-07-09 | Human Genome Sciences, Inc. | Fusion proteins of albumin and interferon beta |
US20050069549A1 (en) | 2002-01-14 | 2005-03-31 | William Herman | Targeted ligands |
AU2003209340A1 (en) * | 2002-01-18 | 2003-09-02 | Bristol-Myers Squibb Company | Predictor sets for tyrosine kinase pathways |
US7094579B2 (en) | 2002-02-13 | 2006-08-22 | Xoma Technology Ltd. | Eukaryotic signal sequences for prokaryotic expression |
JP4364645B2 (en) | 2002-02-14 | 2009-11-18 | 中外製薬株式会社 | Antibody-containing solution formulation |
PT2336184E (en) | 2002-02-25 | 2015-03-09 | Biogen Idec Inc | Administration of agents for the treatment of inflammation |
DE60326214D1 (en) * | 2002-03-01 | 2009-04-02 | Siemens Healthcare Diagnostics | ASSAYS FOR THE MONITORING OF CANCER PATIENTS BASED ON THE MIRRORS OF ANALYTE COMPONENTS OF THE PLASMINOGEN ACTIVATOR SYSTEM IN SAMPLES FROM BODY FLUIDS |
DE60329020D1 (en) | 2002-03-01 | 2009-10-08 | Siemens Healthcare Diagnostics | ASSAYS FOR THE MONITORING OF CANCER PATIENTS BASED ON THE MIRROR OF THE EXTRACELLULAR DOMAIN (ECD) ANALYSIS OF THE EPIDERMAL GROWTH FACTOR RECEPTOR (EGFR), ALONE OR IN COMBINATION WITH OTHER ANALYTES, IN SAMPLES FROM BODY FLUIDS |
ATE475431T1 (en) | 2002-03-04 | 2010-08-15 | Imclone Llc | KDR-SPECIFIC HUMAN ANTIBODIES AND THEIR APPLICATION |
WO2003075845A2 (en) | 2002-03-07 | 2003-09-18 | The Forsyth Institute | Immunogenicity of glucan binding protein |
ES2327830T3 (en) | 2002-03-29 | 2009-11-04 | Schering Corporation | ANTI-INTERLEUQUINA-5 HUMAN MONOCLONAL ANTIBODIES AND METHODS AND COMPOSITIONS CONTAINING THEM. |
WO2003085093A2 (en) * | 2002-04-01 | 2003-10-16 | Human Genome Sciences, Inc. | Antibodies that specifically bind to gmad |
GB0207533D0 (en) | 2002-04-02 | 2002-05-08 | Oxford Glycosciences Uk Ltd | Protein |
US7745192B2 (en) | 2002-04-03 | 2010-06-29 | Venomics Pty Limited | Prothrombin activating protein |
JP2005535572A (en) | 2002-04-12 | 2005-11-24 | メディミューン,インコーポレーテッド | Recombinant anti-interleukin-9 antibody |
ATE512989T1 (en) | 2002-04-15 | 2011-07-15 | Chugai Pharmaceutical Co Ltd | METHOD FOR PRODUCING SCDB LIBRARIES |
ES2342152T3 (en) | 2002-04-17 | 2010-07-02 | Deutsches Krebsforschungszentrum Stiftung Des Offentlichen Rechts | METHOD FOR IDENTIFICATION OF A COMPOUND FOR MODULATION OF WNT SIGNAL WATERFALL. |
US20030206898A1 (en) | 2002-04-26 | 2003-11-06 | Steven Fischkoff | Use of anti-TNFalpha antibodies and another drug |
JP2005529152A (en) | 2002-05-17 | 2005-09-29 | プロテイン デザイン ラブス インコーポレイティド | Treatment of Crohn's disease or psoriasis using anti-interferon gamma antibodies |
CA2485506C (en) * | 2002-05-17 | 2012-02-28 | Alligator Bioscience Ab | A method for in vitro molecular evolution of protein function |
ES2347550T3 (en) | 2002-05-21 | 2010-11-02 | Dsm Ip Assets B.V. | NEW PHOSPHOLIPASES AND USES OF THE SAME. |
AU2003240822A1 (en) | 2002-05-30 | 2003-12-19 | Human Genome Sciences, Inc. | Antibodies that specifically bind to neurokinin b |
EP1513879B1 (en) * | 2002-06-03 | 2018-08-22 | Genentech, Inc. | Synthetic antibody phage libraries |
EP2305710A3 (en) | 2002-06-03 | 2013-05-29 | Genentech, Inc. | Synthetic antibody phage libraries |
US7304128B2 (en) * | 2002-06-04 | 2007-12-04 | E.I. Du Pont De Nemours And Company | Carbon nanotube binding peptides |
NZ537579A (en) | 2002-06-10 | 2006-10-27 | Vaccinex Inc | C35 peptide epitopes and their analogs |
US7425618B2 (en) | 2002-06-14 | 2008-09-16 | Medimmune, Inc. | Stabilized anti-respiratory syncytial virus (RSV) antibody formulations |
US20060002935A1 (en) | 2002-06-28 | 2006-01-05 | Domantis Limited | Tumor Necrosis Factor Receptor 1 antagonists and methods of use therefor |
AU2002368055B2 (en) | 2002-06-28 | 2008-09-18 | The Government Of The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Method of treating autoimmune diseases with interferon-beta and IL-2R antagonist |
US9028822B2 (en) | 2002-06-28 | 2015-05-12 | Domantis Limited | Antagonists against TNFR1 and methods of use therefor |
US9321832B2 (en) | 2002-06-28 | 2016-04-26 | Domantis Limited | Ligand |
US7696320B2 (en) | 2004-08-24 | 2010-04-13 | Domantis Limited | Ligands that have binding specificity for VEGF and/or EGFR and methods of use therefor |
BR0312692A (en) | 2002-07-15 | 2007-06-26 | Univ Texas | selected antibodies and duramycin peptides that bind to anionic phospholipids and aminophospholipids and their uses in the treatment of viral infections and cancer |
USRE47770E1 (en) | 2002-07-18 | 2019-12-17 | Merus N.V. | Recombinant production of mixtures of antibodies |
ES2368733T3 (en) | 2002-07-18 | 2011-11-21 | Merus B.V. | RECOMBINANT PRODUCTION OF MIXTURES OF ANTIBODIES. |
AU2003267999B2 (en) | 2002-07-19 | 2010-03-11 | Abbvie Biotechnology Ltd | Treatment of TNFalpha related disorders |
US7250551B2 (en) | 2002-07-24 | 2007-07-31 | President And Fellows Of Harvard College | Transgenic mice expressing inducible human p25 |
US7794716B2 (en) | 2002-07-25 | 2010-09-14 | Glenveigh Pharmaceuticals, Llc | Antibody composition and passive immunization against pregnancy-induced hypertension |
US7390898B2 (en) | 2002-08-02 | 2008-06-24 | Immunogen Inc. | Cytotoxic agents containing novel potent taxanes and their therapeutic use |
ATE469913T1 (en) | 2002-08-10 | 2010-06-15 | Univ Yale | ANTAGONISTS OF THE NOGO RECEPTOR |
US20040067532A1 (en) | 2002-08-12 | 2004-04-08 | Genetastix Corporation | High throughput generation and affinity maturation of humanized antibody |
CN1681531A (en) | 2002-08-13 | 2005-10-12 | 哈普托恩有限公司 | Methods for the treatment of an infectious bacterial disease with an anti-lactone or lactone derived signal molecules antibody |
EP1534335B9 (en) | 2002-08-14 | 2016-01-13 | Macrogenics, Inc. | Fcgammariib-specific antibodies and methods of use thereof |
WO2004018660A2 (en) | 2002-08-19 | 2004-03-04 | Dsm Ip Assets B.V. | Novel lipases and uses thereof |
AU2003250518A1 (en) | 2002-08-20 | 2004-03-11 | Yeda Research And Development Co. Ltd. | Akap84 and its use for visualization of biological structures |
CA2496272A1 (en) | 2002-08-20 | 2004-03-04 | Millennium Pharmaceuticals, Inc. | Integrin b6 markers for compositions, kits, and methods for identification, assessment, prevention and therapy of cervical cancer |
US20060058511A1 (en) | 2002-08-27 | 2006-03-16 | Chugai Seiyaku Kabushiki Kaisha | Method for stabilizing protein solution preparation |
CA2496596C (en) | 2002-09-04 | 2016-06-28 | Biopolymer Engineering, Inc. | Cancer therapy using yeast insoluble .beta.-glucan particles and antibodies |
US8557743B2 (en) | 2002-09-05 | 2013-10-15 | Dyax Corp. | Display library process |
CN1688198A (en) | 2002-09-10 | 2005-10-26 | 金克克国际有限公司 | Induction of gene expression using a high concentration sugar mixture |
ES2558303T3 (en) | 2002-09-11 | 2016-02-03 | Chugai Seiyaku Kabushiki Kaisha | Protein Purification Method |
WO2010011999A2 (en) | 2008-07-25 | 2010-01-28 | The Regents Of The University Of California | Methods and compositions for eliciting an amyloid-selective immune response |
US7432351B1 (en) | 2002-10-04 | 2008-10-07 | Mayo Foundation For Medical Education And Research | B7-H1 variants |
EP1551876B1 (en) | 2002-10-16 | 2011-03-16 | Purdue Pharma L.P. | Antibodies that bind cell-associated ca 125/0722p and methods of use thereof |
US8506959B2 (en) | 2002-11-01 | 2013-08-13 | Neotope Biosciences Limited | Prevention and treatment of synucleinopathic and amyloidogenic disease |
TW200509968A (en) | 2002-11-01 | 2005-03-16 | Elan Pharm Inc | Prevention and treatment of synucleinopathic disease |
WO2008103472A2 (en) | 2007-02-23 | 2008-08-28 | Elan Pharmaceuticals, Inc. | Prevention and treatment of synucleinopathic and amyloidogenic disease |
CN1787837A (en) | 2002-11-15 | 2006-06-14 | 希龙公司 | Methods for preventing and treating cancer metastasis and bone loss associated with cancer metastasis |
ES2362424T3 (en) | 2003-01-07 | 2011-07-05 | Dyax Corporation | KUNITZ DOMAIN LIBRARY. |
EP2368578A1 (en) | 2003-01-09 | 2011-09-28 | Macrogenics, Inc. | Identification and engineering of antibodies with variant Fc regions and methods of using same |
AU2004205631A1 (en) * | 2003-01-16 | 2004-08-05 | Genentech, Inc. | Synthetic antibody phage libraries |
JP4477579B2 (en) | 2003-01-21 | 2010-06-09 | 中外製薬株式会社 | Antibody light chain screening method |
EP1585815A4 (en) * | 2003-01-21 | 2006-02-22 | Bristol Myers Squibb Co | Polynucleotide encoding a novel acyl coenzyme a, monoacylglycerol acyltransferase-3 (mgat3), and uses thereof |
EP1592387A4 (en) | 2003-01-24 | 2009-05-06 | Elan Pharm Inc | Composition for and treatment of demyelinating diseases and paralysis by administration of remyelinating agents |
MXPA05007940A (en) * | 2003-01-27 | 2007-06-14 | Biogen Idec Inc | Compositions and methods for treating cancer using igsf9 and liv-1. |
DE10303974A1 (en) | 2003-01-31 | 2004-08-05 | Abbott Gmbh & Co. Kg | Amyloid β (1-42) oligomers, process for their preparation and their use |
EP1947116B1 (en) | 2003-02-10 | 2017-06-21 | 2-BBB Medicines B.V. | Differentially expressed nucleic acids in the blood-brain barrier under inflammatory conditions |
EP1638587A4 (en) | 2003-02-14 | 2007-04-18 | Univ Missouri | Contraceptive methods and compositions related to proteasomal interference |
WO2006113909A2 (en) | 2005-04-19 | 2006-10-26 | Seattle Genetics, Inc. | Humanized anti-cd70 binding agents and uses thereof |
JP5356648B2 (en) | 2003-02-20 | 2013-12-04 | シアトル ジェネティックス, インコーポレイテッド | Anti-CD70 antibody-drug conjugates and their use for the treatment of cancer and immune disorders |
US20040180387A1 (en) | 2003-03-13 | 2004-09-16 | Fujirebio Diagnostics, Inc. | Detection of urinary mesothelin-/megakaryocyte potentiating factor-related peptides for assessment of ovarian cancer |
EP2184298A1 (en) | 2003-03-14 | 2010-05-12 | Wyeth a Corporation of the State of Delaware | Antibodies against human IL-21 receptor and uses therefor |
PT2248899E (en) | 2003-03-19 | 2015-09-23 | Biogen Ma Inc | Nogo receptor binding protein |
WO2004083865A2 (en) | 2003-03-20 | 2004-09-30 | Novartis Forschungsstiftung Zweigniederlassung Friedrich Miescher Institute For Biomedical Research | Materials and methods for modulating cell motility |
EP1622941A2 (en) * | 2003-03-20 | 2006-02-08 | ImClone Systems Incorporated | Method of producing an antibody to epidermal growth factor receptor |
US7294701B2 (en) * | 2003-04-02 | 2007-11-13 | Technion Research & Development Foundation Ltd. | Antibody fragment capable of modulating multidrug resistance and compositions and kits and methods using same |
KR101224235B1 (en) | 2003-04-11 | 2013-01-25 | 메디뮨 엘엘씨 | Recombinant IL-9 Antibodies and Uses Thereof |
US7321065B2 (en) | 2003-04-18 | 2008-01-22 | The Regents Of The University Of California | Thyronamine derivatives and analogs and methods of use thereof |
US20040208876A1 (en) | 2003-04-18 | 2004-10-21 | Kim Kyung Jin | Monoclonal antibodies to hepatocyte growth factor |
GB2401040A (en) | 2003-04-28 | 2004-11-03 | Chugai Pharmaceutical Co Ltd | Method for treating interleukin-6 related diseases |
WO2005016970A2 (en) | 2003-05-01 | 2005-02-24 | Imclone Systems Incorporated | Fully human antibodies directed against the human insulin-like growth factor-1 receptor |
TWI353991B (en) | 2003-05-06 | 2011-12-11 | Syntonix Pharmaceuticals Inc | Immunoglobulin chimeric monomer-dimer hybrids |
SI2298347T1 (en) | 2003-05-06 | 2016-03-31 | Biogen Hemophilia Inc. | Clotting factor chimeric proteins for treatment of a hemostatic disorder |
US20050025763A1 (en) | 2003-05-08 | 2005-02-03 | Protein Design Laboratories, Inc. | Therapeutic use of anti-CS1 antibodies |
US7709610B2 (en) | 2003-05-08 | 2010-05-04 | Facet Biotech Corporation | Therapeutic use of anti-CS1 antibodies |
AU2004239065B2 (en) | 2003-05-14 | 2008-05-15 | Domantis Limited | A process for recovering polypeptides that unfold reversibly from a polypeptide repertoire |
US8088387B2 (en) | 2003-10-10 | 2012-01-03 | Immunogen Inc. | Method of targeting specific cell populations using cell-binding agent maytansinoid conjugates linked via a non-cleavable linker, said conjugates, and methods of making said conjugates |
US20050014932A1 (en) | 2003-05-15 | 2005-01-20 | Iogenetics, Llc | Targeted biocides |
PT1633189T (en) | 2003-05-19 | 2017-10-04 | Prothena Biosciences Ltd | Truncated fragments of alpha-synuclein in lewy body disease |
US7358331B2 (en) | 2003-05-19 | 2008-04-15 | Elan Pharmaceuticals, Inc. | Truncated fragments of alpha-synuclein in Lewy body disease |
CA2525130C (en) | 2003-05-20 | 2014-04-15 | Immunogen, Inc. | Improved cytotoxic agents comprising new maytansinoids |
US9708410B2 (en) | 2003-05-30 | 2017-07-18 | Janssen Biotech, Inc. | Anti-tissue factor antibodies and compositions |
US20100069614A1 (en) | 2008-06-27 | 2010-03-18 | Merus B.V. | Antibody producing non-human mammals |
CA2527694C (en) | 2003-05-30 | 2015-07-14 | Hendricus Renerus Jacobus Mattheus Hoogenboom | Fab library for the preparation of anti vegf and anti rabies virus fabs |
CA2542232A1 (en) | 2003-06-09 | 2005-01-20 | Alnylam Pharmaceuticals, Inc. | Method for treating neurodegenerative disease by inhibiting alpha-synuclein |
US20040248109A1 (en) * | 2003-06-09 | 2004-12-09 | Lawrence Greenfield | Methods for selecting protein binding moieties |
JP4794301B2 (en) | 2003-06-11 | 2011-10-19 | 中外製薬株式会社 | Antibody production method |
DE602004028249D1 (en) | 2003-06-18 | 2010-09-02 | Chugai Pharmaceutical Co Ltd | FUCOSETRANSPORTER |
US20060162014A1 (en) | 2003-07-07 | 2006-07-20 | Jaffe Eileen K | Alternate morpheeins of allosteric proteins as a target for the development of bioactive molecules |
US8153410B2 (en) | 2003-07-07 | 2012-04-10 | Fox Chase Cancer Center | Alternate morpheein forms of allosteric proteins as a target for the development of bioactive molecules |
WO2005010040A1 (en) | 2003-07-15 | 2005-02-03 | Barros Research Institute | Eimeria tenella antigen for immunotherapy of coccidiosis |
GB0407315D0 (en) | 2003-07-15 | 2004-05-05 | Cambridge Antibody Tech | Human antibody molecules |
WO2005010163A2 (en) * | 2003-07-15 | 2005-02-03 | Barros Research Institute | Compositions and methods for immunotherapy of human immunotherapy of human immunodeficiency virus (hiv) |
CA2533512C (en) | 2003-07-25 | 2013-06-11 | Amgen Inc. | Antagonists and agonists of ldcam and methods of use |
US7727752B2 (en) | 2003-07-29 | 2010-06-01 | Life Technologies Corporation | Kinase and phosphatase assays |
US20050106667A1 (en) | 2003-08-01 | 2005-05-19 | Genentech, Inc | Binding polypeptides with restricted diversity sequences |
US7758859B2 (en) | 2003-08-01 | 2010-07-20 | Genentech, Inc. | Anti-VEGF antibodies |
HN2004000285A (en) | 2003-08-04 | 2006-04-27 | Pfizer Prod Inc | ANTIBODIES DIRECTED TO c-MET |
EP2311468B1 (en) | 2003-08-08 | 2014-01-15 | Perseus Proteomics Inc. | Gene overexpressed in cancer |
CA2534661A1 (en) | 2003-08-08 | 2005-02-17 | Genenews Inc. | Osteoarthritis biomarkers and uses thereof |
EP2272566A3 (en) | 2003-08-18 | 2013-01-02 | MedImmune, LLC | Humanisation of antibodies |
AR045563A1 (en) | 2003-09-10 | 2005-11-02 | Warner Lambert Co | ANTIBODIES DIRECTED TO M-CSF |
US7046714B2 (en) * | 2003-09-10 | 2006-05-16 | Intel Corporation | Method and apparatus for Raman ring resonator based laser/wavelength converter |
IL158287A0 (en) | 2003-10-07 | 2004-05-12 | Yeda Res & Dev | Antibodies to nik, their preparation and use |
EP1670350A4 (en) | 2003-10-07 | 2008-02-13 | Millennium Pharm Inc | Nucleic acid molecules and proteins for the identification, assessment, prevention, and therapy of ovarian cancer |
ES2437491T3 (en) | 2003-10-10 | 2014-01-10 | Alchemia Oncology Pty Limited | Modulation of the synthesis and degradation of hyaluronan in the treatment of disease |
PL2157192T3 (en) | 2003-10-10 | 2014-01-31 | Deutsches Krebsforsch | Compositions for diagnosis and therapy of diseases associated with aberrant expression of futrins (R-Spondins) |
CA2537662A1 (en) * | 2003-10-15 | 2005-05-06 | F. Hoffmann-La Roche Ag | Use of protein asc as a marker for breast cancer |
CA2542638A1 (en) | 2003-10-16 | 2005-04-28 | Imclone Systems Incorporated | Fibroblast growth factor receptor-1 inhibitors and methods of treatment thereof |
US7329725B1 (en) * | 2003-10-29 | 2008-02-12 | Nastech Pharmaceutical Company Inc. | Phage displayed Trp cage ligands |
GB0325836D0 (en) * | 2003-11-05 | 2003-12-10 | Celltech R&D Ltd | Biological products |
CA2545603A1 (en) | 2003-11-12 | 2005-05-26 | Biogen Idec Ma Inc. | Neonatal fc receptor (fcrn)-binding polypeptide variants, dimeric fc binding proteins and methods related thereto |
US20050100965A1 (en) | 2003-11-12 | 2005-05-12 | Tariq Ghayur | IL-18 binding proteins |
JP4833850B2 (en) | 2003-11-21 | 2011-12-07 | ユセベ ファルマ ソシエテ アノニム | Method for treating multiple sclerosis by inhibiting IL-17 activity |
JP4949038B2 (en) | 2003-12-01 | 2012-06-06 | ダコ デンマーク アクティーゼルスカブ | Methods and compositions for immunohistochemical detection |
US20050158323A1 (en) * | 2003-12-04 | 2005-07-21 | Vaccinex, Inc. | Methods of killing tumor cells by targeting internal antigens exposed on apoptotic tumor cells |
CA2546054C (en) | 2003-12-10 | 2014-05-13 | Medarex, Inc. | Interferon alpha antibodies and their uses |
PL1691837T3 (en) | 2003-12-10 | 2012-11-30 | Squibb & Sons Llc | Ip-10 antibodies and their uses |
TW200530269A (en) | 2003-12-12 | 2005-09-16 | Chugai Pharmaceutical Co Ltd | Anti-Mpl antibodies |
WO2005061532A1 (en) * | 2003-12-23 | 2005-07-07 | Berthet Francois Xavier | Pathogenic infection detection compositions and methods |
GB0329825D0 (en) * | 2003-12-23 | 2004-01-28 | Celltech R&D Ltd | Biological products |
JP4943161B2 (en) | 2003-12-23 | 2012-05-30 | ジェネンテック, インコーポレイテッド | Treatment of cancer with a novel anti-IL13 monoclonal antibody |
DK1704166T3 (en) | 2004-01-07 | 2015-06-01 | Novartis Vaccines & Diagnostic | M-CSF-SPECIFIC MONOCLONAL ANTIBODY AND APPLICATIONS THEREOF |
SV2006001990A (en) | 2004-01-09 | 2006-01-30 | Pfizer | ANTIBODIES AGAINST MADCAM |
EP1737971B1 (en) | 2004-01-20 | 2017-08-16 | Merus N.V. | Mixtures of binding proteins |
US20060014211A1 (en) | 2004-01-21 | 2006-01-19 | Fujirebio Diagnostics, Inc. | Detection of mesothelin-/megakaryocyte potentiating factor-related peptides for assessment of the peritoneum and the peritoneal cavity |
GB0401876D0 (en) | 2004-01-28 | 2004-03-03 | Vereniging Het Nl Kanker I | New use for cancer antigen |
BRPI0507026A (en) | 2004-02-09 | 2007-04-17 | Human Genome Sciences Inc | albumin fusion proteins |
EP2340850A1 (en) | 2004-02-10 | 2011-07-06 | The Regents of the University of Colorado, a Body Corporate | Inhibition of factor B, the alternative complement pathway and methods related thereto |
EP2168986A3 (en) | 2004-02-19 | 2010-07-28 | Genentech, Inc. | CDR-repaired antibodies |
JP5557982B2 (en) | 2004-03-01 | 2014-07-23 | イミューン ディズィーズ インスティテュート インコーポレイテッド | Natural IgM antibodies and inhibitors thereof |
ES2387809T3 (en) * | 2004-03-19 | 2012-10-02 | Imclone Llc | Antibody to human epidermal growth factor receptor |
KR20110027823A (en) | 2004-03-24 | 2011-03-16 | 트리패스 이미징, 인코포레이티드 | Methods and compositions for the detection of cervical disease |
US7973139B2 (en) | 2004-03-26 | 2011-07-05 | Human Genome Sciences, Inc. | Antibodies against nogo receptor |
GB0407008D0 (en) | 2004-03-27 | 2004-04-28 | Haptogen Ltd | Methods for inducing rapid cell death (autolysis) in infectious bacteria |
MXPA06011199A (en) * | 2004-03-31 | 2007-04-16 | Genentech Inc | Humanized anti-tgf-beta antibodies. |
US7785903B2 (en) | 2004-04-09 | 2010-08-31 | Genentech, Inc. | Variable domain library and uses |
TWI439284B (en) | 2004-04-09 | 2014-06-01 | Abbvie Biotechnology Ltd | Multiple-variable dose regimen for treating tnfα-related disorders |
EP2207033B1 (en) | 2004-04-15 | 2014-06-18 | University of Florida Research Foundation, Inc. | Neural proteins as biomarkers for nervous system injury and other neural disorders |
WO2005103086A1 (en) | 2004-04-23 | 2005-11-03 | Bundesrepublik Deutschland letztvertreten durch das Robert-Koch-Institut vertreten durch seinen Präsidenten | Method for the treatment of t cell mediated conditions by depletion of icos-positive cells in vivo |
GB0410627D0 (en) | 2004-05-12 | 2004-06-16 | Scancell Ltd | Specific binding members |
GB0410958D0 (en) | 2004-05-15 | 2004-06-16 | Haptogen Ltd | Methods for reducing biofilm formation in infectious bacteria |
EP1747021B1 (en) * | 2004-05-19 | 2015-09-09 | E. R. Squibb & Sons, L.L.C. | Self-immolative linkers and drug conjugates |
US7691962B2 (en) * | 2004-05-19 | 2010-04-06 | Medarex, Inc. | Chemical linkers and conjugates thereof |
ATE505727T1 (en) | 2004-05-26 | 2011-04-15 | Fraunhofer Ges Forschung | ISOLATION OF ALLERGEN-SPECIFIC IMMUNOGLOBULIN GENES FROM HUMAN B CELLS OF ATOPIC NUCLEARS |
US9228008B2 (en) | 2004-05-28 | 2016-01-05 | Idexx Laboratories, Inc. | Canine anti-CD20 antibodies |
CA2569240A1 (en) | 2004-06-01 | 2005-12-15 | Domantis Limited | Drug fusion comprising a polypeptide drug and an immunoglobulin heavy chain variable domain specific for serum albumin |
WO2005118810A1 (en) | 2004-06-03 | 2005-12-15 | Athlomics Pty Ltd | Agents and methods for diagnosing stress |
US7728114B2 (en) | 2004-06-03 | 2010-06-01 | Novimmune S.A. | Anti-CD3 antibodies and methods of use thereof |
WO2005123048A2 (en) | 2004-06-21 | 2005-12-29 | Proteome Sciences Plc | Screening methods using c-abl, fyn and syk in combination with tau protein |
CA2570823C (en) | 2004-06-21 | 2015-02-24 | Medarex, Inc. | Interferon alpha receptor 1 antibodies and their uses |
GB0414054D0 (en) | 2004-06-23 | 2004-07-28 | Owen Mumford Ltd | Improvements relating to automatic injection devices |
ES2395094T3 (en) | 2004-06-24 | 2013-02-08 | Biogen Idec Ma Inc. | Treatment of conditions that involve demyelination |
EP2322554A1 (en) | 2004-06-30 | 2011-05-18 | Domantis Limited | Composition comprising an anti-TNF-alpha domain antibody for the treatment of rheumatoid arthritis |
MX2007000103A (en) * | 2004-07-06 | 2007-05-11 | Bioren Inc | Universal antibody libraries. |
US7973134B2 (en) * | 2004-07-07 | 2011-07-05 | Cell Signaling Technology, Inc. | Reagents for the detection of protein phosphorylation in anaplastic large cell lymphoma signaling pathways |
US6986264B1 (en) * | 2004-07-15 | 2006-01-17 | Carrier Corporation | Economized dehumidification system |
CA2573821A1 (en) | 2004-07-16 | 2006-01-26 | Pfizer Products Inc. | Combination treatment for non-hematologic malignancies using an anti-igf-1r antibody |
US7342093B2 (en) | 2004-07-23 | 2008-03-11 | University Of Massachusetts | Compounds that inhibit Hsp90 protein-protein interactions with IAP proteins |
PL1781321T3 (en) | 2004-08-02 | 2014-07-31 | Zenyth Operations Pty Ltd | A method of treating cancer comprising a vegf-b antagonist |
US7846438B2 (en) | 2004-08-03 | 2010-12-07 | Biogen Idec Ma Inc. | Methods of promoting neurite outgrowth with soluble TAJ polypeptides |
WO2006135382A2 (en) | 2004-08-04 | 2006-12-21 | Chemocentryx, Inc. | Enzymatic activities in chemokine-mediated inflammation |
EP1623996A1 (en) * | 2004-08-06 | 2006-02-08 | Deutsches Krebsforschungszentrum Stiftung des öffentlichen Rechts | Improved method of selecting a desired protein from a library |
MX2007001679A (en) | 2004-08-09 | 2007-05-23 | Elan Pharm Inc | Prevention and treatment of synucleinopathic and amyloidogenic disease. |
ITRM20040406A1 (en) * | 2004-08-10 | 2004-11-10 | Bait Biotecnologie Applicate Italiane Srl | COMPLEX ABLE TO DETECT AN ANALITY, PROCEDURE FOR ITS PREPARATION AND USES OF IT. |
RS57636B1 (en) * | 2004-09-03 | 2018-11-30 | Genentech Inc | Humanized anti-beta7 antagonists and uses therefor |
JP2008518586A (en) * | 2004-09-09 | 2008-06-05 | ユニバーシティ オブ ワシントン | All-trans retinol, or all-trans 13,14-dihydroretinol saturase and method of use |
FI20041204A0 (en) | 2004-09-16 | 2004-09-16 | Riikka Lund | Methods for the utilization of new target genes associated with immune-mediated diseases |
US7563443B2 (en) | 2004-09-17 | 2009-07-21 | Domantis Limited | Monovalent anti-CD40L antibody polypeptides and compositions thereof |
EP3073267A1 (en) | 2004-09-21 | 2016-09-28 | Medimmune, Inc. | Antibodies against and methods for producing vaccines for respiratory syncytial virus |
GB0421838D0 (en) | 2004-09-30 | 2004-11-03 | Congenia S R L | Cancer markers |
US7935790B2 (en) | 2004-10-04 | 2011-05-03 | Cell Singaling Technology, Inc. | Reagents for the detection of protein phosphorylation in T-cell receptor signaling pathways |
MX2007004176A (en) | 2004-10-06 | 2007-06-15 | Mayo Foundation | B7-h1 and methods of diagnosis, prognosis, and treatment of cancer. |
CN101724071A (en) | 2004-10-08 | 2010-06-09 | 杜门蒂斯有限公司 | Single domain antibodies against TNFRl and methods of use therefor |
WO2006047417A2 (en) | 2004-10-21 | 2006-05-04 | University Of Florida Research Foundation, Inc. | Detection of cannabinoid receptor biomarkers and uses thereof |
WO2006055178A2 (en) | 2004-10-25 | 2006-05-26 | Merck & Co., Inc. | Anti-addl antibodies and uses thereof |
CA2585717A1 (en) | 2004-10-27 | 2006-05-04 | Medimmune Inc. | Modulation of antibody specificity by tailoring the affinity to cognate antigens |
WO2006050257A2 (en) * | 2004-10-29 | 2006-05-11 | Massachusetts Institute Of Tecchnology | Detection of ion channel or receptor activity |
DE602005014665D1 (en) | 2004-11-09 | 2009-07-09 | Philogen Spa | ANTIBODY AGAINST TENASCIN-C |
ES2523457T3 (en) | 2004-11-18 | 2014-11-26 | Imclone Llc | Antibodies against vascular endothelial growth factor receptor 1 |
GB0426146D0 (en) | 2004-11-29 | 2004-12-29 | Bioxell Spa | Therapeutic peptides and method |
CA2589374C (en) | 2004-11-30 | 2016-05-03 | Curagen Corporation | Antibodies directed to gpnmb and uses thereof |
CN101128487B (en) | 2004-12-02 | 2012-10-10 | 杜门蒂斯有限公司 | Bispecific domain antibodies targeting serum albumin and GLP-1 or PYY |
GB0521621D0 (en) | 2005-10-24 | 2005-11-30 | Domantis Ltd | Tumor necrosis factor receptor 1 antagonists for treating respiratory diseases |
US7517870B2 (en) | 2004-12-03 | 2009-04-14 | Fondazione Telethon | Use of compounds that interfere with the hedgehog signaling pathway for the manufacture of a medicament for preventing, inhibiting, and/or reversing ocular diseases related with ocular neovascularization |
WO2006061723A2 (en) | 2004-12-06 | 2006-06-15 | Kirin Beer Kabushiki Kaisha | Human monoclonal antibodies to influenza m2 protein and methods of making and using same |
TW200635607A (en) | 2004-12-15 | 2006-10-16 | Elan Pharm Inc | Humanized Aβ antibodies for use in improving cognition |
US7807789B2 (en) * | 2004-12-21 | 2010-10-05 | Cell Signaling Technology, Inc. | Reagents for the detection of protein phosphorylation in EGFR-signaling pathways |
ES2325552T3 (en) * | 2004-12-22 | 2009-09-08 | Merck Serono Sa | COMBINATION TREATMENT FOR MULTIPLE SCLEROSIS. |
US20090061485A1 (en) | 2004-12-22 | 2009-03-05 | Chugai Seiyaku Kabushiki Kaisha | Method of Producing an Antibody Using a Cell in Which the Function of Fucose Transporter Is Inhibited |
US7850960B2 (en) | 2004-12-30 | 2010-12-14 | University Of Washington | Methods for regulation of stem cells |
SG173313A1 (en) | 2005-01-05 | 2011-08-29 | Biogen Idec Inc | Cripto binding molecules |
GT200600031A (en) | 2005-01-28 | 2006-08-29 | ANTI-BETA ANTIBODY FORMULATION | |
EP2520669A3 (en) | 2005-02-07 | 2013-02-27 | GeneNews Inc. | Mild osteoathritis biomarkers and uses thereof |
BRPI0607639B1 (en) | 2005-02-08 | 2022-04-05 | Genzyme Corporation | Human antibody molecules or antigen-binding fragments thereof that bind and neutralize tgf-beta1, 2 and 3, their use and pharmaceutical composition |
US20110166319A1 (en) * | 2005-02-11 | 2011-07-07 | Immunogen, Inc. | Process for preparing purified drug conjugates |
AU2006213662B2 (en) | 2005-02-11 | 2010-08-05 | Immunogen, Inc. | Process for preparing stable drug conjugates |
CN103920142A (en) | 2005-02-14 | 2014-07-16 | 爱荷华大学研究基金会 | Methods And Reagents For Treatment Of Age-related Macular Degeneration |
US20060233791A1 (en) | 2005-02-15 | 2006-10-19 | Duke University | Anti-CD19 antibodies and uses in oncology |
JP2008531730A (en) | 2005-03-04 | 2008-08-14 | キュアーディーエム、インク. | Methods and pharmaceutical compositions for treating type I diabetes mellitus and other conditions |
US20090142338A1 (en) * | 2005-03-04 | 2009-06-04 | Curedm, Inc. | Methods and Compositions for Treating Type 1 and Type 2 Diabetes Mellitus and Related Conditions |
JP5153613B2 (en) | 2005-03-18 | 2013-02-27 | メディミューン,エルエルシー | Antibody framework shuffle |
JP2008532559A (en) | 2005-03-19 | 2008-08-21 | メディカル リサーチ カウンシル | Treatment and prevention of viral infection or improvement of treatment and prevention |
SG10201912554TA (en) | 2005-03-23 | 2020-02-27 | Genmab As | Antibodies against cd38 for treatment of multiple myeloma |
EP1866339B8 (en) | 2005-03-25 | 2021-12-01 | GITR, Inc. | Gitr binding molecules and uses therefor |
TW200722518A (en) | 2005-03-31 | 2007-06-16 | Chugai Pharmaceutical Co Ltd | Sc(fv)2 structural isomers |
US10011858B2 (en) | 2005-03-31 | 2018-07-03 | Chugai Seiyaku Kabushiki Kaisha | Methods for producing polypeptides by regulating polypeptide association |
GB0506912D0 (en) | 2005-04-05 | 2005-05-11 | Celltech R&D Ltd | Biological products |
US7714016B2 (en) * | 2005-04-08 | 2010-05-11 | Medarex, Inc. | Cytotoxic compounds and conjugates with cleavable substrates |
US20090099340A1 (en) * | 2007-10-12 | 2009-04-16 | Cell Signaling Technology, Inc. | Reagents for the detection of protein phosphorylation in carcinoma signaling pathways |
CA2605024C (en) | 2005-04-15 | 2018-05-22 | Macrogenics, Inc. | Covalent diabodies and uses thereof |
WO2008157379A2 (en) | 2007-06-21 | 2008-12-24 | Macrogenics, Inc. | Covalent diabodies and uses thereof |
US20060269556A1 (en) * | 2005-04-18 | 2006-11-30 | Karl Nocka | Mast cell activation using siglec 6 antibodies |
ATE505489T1 (en) | 2005-04-22 | 2011-04-15 | Lilly Co Eli | TGF-BETA-1 SPECIFIC ANTIBODIES |
EP1877075A4 (en) | 2005-04-25 | 2008-07-30 | Pfizer | Antibodies to myostatin |
BRPI0608096A2 (en) | 2005-04-26 | 2009-11-10 | Pfizer | p-cadherin antibodies |
US7595380B2 (en) | 2005-04-27 | 2009-09-29 | Tripath Imaging, Inc. | Monoclonal antibodies and methods for their use in the detection of cervical disease |
US7592429B2 (en) | 2005-05-03 | 2009-09-22 | Ucb Sa | Sclerostin-binding antibody |
EP1885755A4 (en) | 2005-05-05 | 2009-07-29 | Univ Duke | Anti-cd19 antibody therapy for autoimmune disease |
LT2439273T (en) | 2005-05-09 | 2019-05-10 | Ono Pharmaceutical Co., Ltd. | Human monoclonal antibodies to programmed death 1(PD-1) and methods for treating cancer using anti-PD-1 antibodies alone or in combination with other immunotherapeutics |
NZ591701A (en) | 2005-05-16 | 2012-11-30 | Abbott Biotech Ltd | Use of tnf inhibitor for treatment of erosive polyarthritis |
PL1899364T3 (en) | 2005-05-17 | 2020-08-24 | University Of Connecticut | Compositions and methods for immunomodulation in an organism |
US7393919B2 (en) * | 2005-05-25 | 2008-07-01 | Cure Dm, Inc. | Peptides, derivatives and analogs thereof, and methods of using same |
US8911733B2 (en) | 2005-05-26 | 2014-12-16 | Musc Foundation For Research Development | Inhibition of the alternative complement pathway for treatment of traumatic brain injury, spinal cord injury and related conditions |
CN102441163A (en) | 2005-05-27 | 2012-05-09 | 比奥根艾迪克Ma公司 | Tweak binding antibodies |
WO2006129843A2 (en) | 2005-05-31 | 2006-12-07 | Canon Kabushiki Kaisha | Bispecific capturing molecule |
WO2006129828A2 (en) | 2005-05-31 | 2006-12-07 | Canon Kabushiki Kaisha | Target substance capturing molecule |
JP2006333825A (en) * | 2005-06-03 | 2006-12-14 | Canon Inc | Method for producing protein for catching target substance and method for selecting constituting material of the same |
JP5085322B2 (en) | 2005-06-10 | 2012-11-28 | 中外製薬株式会社 | Pharmaceutical composition containing sc (Fv) 2 |
JP5068167B2 (en) | 2005-06-10 | 2012-11-07 | 中外製薬株式会社 | Stabilizer for protein preparation containing meglumine and use thereof |
EA015148B1 (en) | 2005-06-17 | 2011-06-30 | Элан Фарма Интернэшнл Лимитед | METHODS OF PURIFYING Aβ BINDING PROTEIN HAVING A Fc REGION |
EP2937360A1 (en) * | 2005-06-17 | 2015-10-28 | Merck Sharp & Dohme Corp. | Ilt3 binding molecules and uses therefor |
WO2007094842A2 (en) | 2005-12-02 | 2007-08-23 | Genentech, Inc. | Binding polypeptides and uses thereof |
KR20080025174A (en) | 2005-06-23 | 2008-03-19 | 메디뮨 인코포레이티드 | Antibody formulations having optimized aggregation and fragmentation profiles |
US7700739B2 (en) * | 2005-06-30 | 2010-04-20 | Abbott Laboratories | IL-12/p40 binding proteins |
JP5142458B2 (en) * | 2005-06-30 | 2013-02-13 | キヤノン株式会社 | Target substance capture molecule, target substance capture element, target substance detection apparatus and kit using these, and target substance detection method |
CN105330741B (en) | 2005-07-01 | 2023-01-31 | E.R.施贵宝&圣斯有限责任公司 | Human monoclonal antibodies to programmed death ligand 1 (PD-L1) |
EP2476761A3 (en) | 2005-07-07 | 2012-10-17 | Athlomics Pty Ltd | Polynucleotide marker genes and their expression, for diagnosis of endotoxemia |
US7482124B2 (en) * | 2005-07-08 | 2009-01-27 | Bristol-Myers Squibb Company | Method of identifying a PPARgamma-agonist compound having a decreased likelihood of inducing dose-dependent peripheral edema |
MX2008000253A (en) | 2005-07-08 | 2008-04-02 | Biogen Idec Inc | Sp35 antibodies and uses thereof. |
JP5457671B2 (en) | 2005-07-28 | 2014-04-02 | ノバルティス アーゲー | M-CSF specific monoclonal antibody and use thereof |
CN109187944A (en) | 2005-08-02 | 2019-01-11 | 埃克斯生物科技公司 | Using the diagnosis of IL-1 α autoantibody, treat and prevent vascular diseases |
WO2007014433A1 (en) | 2005-08-03 | 2007-02-08 | Grains Research & Development Corporation | Polysaccharide synthases |
SI2573114T1 (en) | 2005-08-10 | 2016-08-31 | Macrogenics, Inc. | Identification and engineering of antibodies with variant Fc regions and methods of using same |
AU2006281980A1 (en) * | 2005-08-15 | 2007-02-22 | Cephalon Australia Pty Ltd | Engineered antibodies with new world primate framework regions |
ATE497392T1 (en) | 2005-08-18 | 2011-02-15 | Genmab As | THERAPY WITH ANTI-CD4 ANTIBODIES AND RADIATION |
RU2515108C2 (en) | 2005-08-19 | 2014-05-10 | Эббви Инк | Immunoglobulin with double variable domains and its applications |
US20090215992A1 (en) * | 2005-08-19 | 2009-08-27 | Chengbin Wu | Dual variable domain immunoglobulin and uses thereof |
EP2500356A3 (en) | 2005-08-19 | 2012-10-24 | Abbott Laboratories | Dual variable domain immunoglobulin and uses thereof |
US20070202512A1 (en) * | 2005-08-19 | 2007-08-30 | Bristol-Myers Squibb Company | Human single nucleotide polymorphisms associated with dose-dependent weight gain and methods of use thereof |
ES2534760T3 (en) | 2005-08-19 | 2015-04-28 | Wyeth Llc | Antagonist antibodies against GDF-8 and their uses in the treatment of ALS and other disorders associated with GDF-8 |
US7612181B2 (en) * | 2005-08-19 | 2009-11-03 | Abbott Laboratories | Dual variable domain immunoglobulin and uses thereof |
US20070041905A1 (en) | 2005-08-19 | 2007-02-22 | Hoffman Rebecca S | Method of treating depression using a TNF-alpha antibody |
AU2006283726C1 (en) | 2005-08-24 | 2015-05-07 | Immunogen, Inc. | Process for preparing maytansinoid antibody conjugates |
WO2007027906A2 (en) | 2005-08-31 | 2007-03-08 | Cell Signaling Technology, Inc. | Reagents for the detection of protein phosphorylation in leukemia signaling pathways |
US20100151495A9 (en) * | 2005-08-31 | 2010-06-17 | Cell Signaling Technolgy, Inc. | Reagents for the detection of protein phosphorylation in carcinoma signaling pathways |
UA94060C2 (en) | 2005-09-07 | 2011-04-11 | Эмджен Фримонт Инк. | Monoclonal antibodies that specifically binds alk-1 |
US8945573B2 (en) | 2005-09-08 | 2015-02-03 | The Henry M. Jackson Foundation For The Advancement Of Military Medicine, Inc. | Targeted identification of immunogenic peptides |
WO2007030560A2 (en) | 2005-09-08 | 2007-03-15 | Philadelphia Health & Education Corporation, D/B/A Drexel University College Of Medicine | Identification of modulators of serine protease inhibitor kazal and their use as anti-cancer and anti-viral agents |
CA2620362A1 (en) * | 2005-09-14 | 2007-03-22 | Ucb Pharma S.A. | Comb polymers |
US9062126B2 (en) | 2005-09-16 | 2015-06-23 | Raptor Pharmaceuticals Inc. | Compositions comprising receptor-associated protein (RAP) variants specific for CR-containing proteins and uses thereof |
EP1934261B1 (en) | 2005-09-26 | 2014-10-29 | Medarex, L.L.C. | Human monoclonal antibodies to cd70 |
CN101312748A (en) | 2005-09-26 | 2008-11-26 | 梅达莱克斯公司 | Antibody-drug conjugates and methods of use |
US8906864B2 (en) | 2005-09-30 | 2014-12-09 | AbbVie Deutschland GmbH & Co. KG | Binding domains of proteins of the repulsive guidance molecule (RGM) protein family and functional fragments thereof, and their use |
CA2625773C (en) | 2005-10-14 | 2015-05-12 | Fukuoka University | Inhibition of interleukin-6 (il-6) receptor promotes pancreatic islet transplantation |
GB0521139D0 (en) | 2005-10-18 | 2005-11-23 | Univ Sheffield | Therapeutic agent |
EP2532679B1 (en) | 2005-10-21 | 2017-04-12 | Novartis AG | Human antibodies against il13 and therapeutic uses |
ATE518007T1 (en) | 2005-10-21 | 2011-08-15 | Genenews Inc | METHOD AND APPARATUS FOR CORRELING LEVELS OF BIOMARKER PRODUCTS WITH DISEASES |
BRPI0617664B8 (en) | 2005-10-21 | 2021-05-25 | Chugai Pharmaceutical Co Ltd | use of an antibody recognizing IL-6 for the production of a pharmaceutical composition to treat myocardial infarction or suppress left ventricular remodeling after myocardial infarction |
EP1948675B1 (en) | 2005-10-25 | 2014-07-30 | The Johns Hopkins University | Methods and compositions for the treatment of marfan syndrome and associated disorders |
ES2375843T3 (en) | 2005-10-26 | 2012-03-06 | Medarex, Inc. | PROCEDURES AND COMPOUNDS FOR THE PREPARATION OF ANC? LOGOS OF CC-1065. |
EP1948680A4 (en) | 2005-10-28 | 2010-01-13 | Univ California | Methods and compounds for lymphoma cell detection and isolation |
EP1948235B1 (en) | 2005-11-01 | 2013-08-28 | AbbVie Biotechnology Ltd | Methods for determining efficacy of adalimumab in subjects having ankylosing spondylitis using ctx-ii and mmp3 as biomarkers |
US20070099246A1 (en) * | 2005-11-03 | 2007-05-03 | Sandy John D | Antibodies, assays and kits to quantitate cartilage destruction |
PL2500030T5 (en) | 2005-11-04 | 2019-02-28 | Genentech, Inc. | Use of complement pathway inhibitors to treat ocular diseases |
MX2008005764A (en) | 2005-11-04 | 2008-11-18 | Biogen Idec Inc | Methods for promoting neurite outgrowth and survival of dopaminergic neurons. |
ES2577292T3 (en) | 2005-11-07 | 2016-07-14 | Genentech, Inc. | Binding polypeptides with diversified VH / VL hypervariable sequences and consensus |
JP5191392B2 (en) | 2005-11-07 | 2013-05-08 | ザ スクリプス リサーチ インスティチュート | Compositions and methods for modulating the specificity of tissue factor signaling |
UA96139C2 (en) | 2005-11-08 | 2011-10-10 | Дженентек, Інк. | Anti-neuropilin-1 (nrp1) antibody |
WO2007059404A2 (en) | 2005-11-10 | 2007-05-24 | Medarex, Inc. | Duocarmycin derivatives as novel cytotoxic compounds and conjugates |
EP1949109B1 (en) | 2005-11-14 | 2012-02-29 | MetaMol Theranostics, LLC | Peptide sequence that promotes tumor invasion |
EP1964574B1 (en) | 2005-11-14 | 2016-09-07 | Cellmid Limited | Method for treatment or prevention of disease associated with functional disorder of regulatory t cell |
AR057582A1 (en) | 2005-11-15 | 2007-12-05 | Nat Hospital Organization | AGENTS TO DELETE INDUCTION OF CYTOTOXIC T LYMPHOCYTES |
EP1957541A2 (en) * | 2005-11-21 | 2008-08-20 | Laboratoires Serono SA | Compositions and methods of producing hybrid antigen binding molecules and uses thereof |
TWI461436B (en) | 2005-11-25 | 2014-11-21 | Kyowa Hakko Kirin Co Ltd | Human monoclonal antibody human cd134 (ox40) and methods of making and using same |
WO2007061029A1 (en) | 2005-11-25 | 2007-05-31 | Keio University | Therapeutic agent for prostate cancer |
EP2805971A1 (en) | 2005-11-28 | 2014-11-26 | ZymoGenetics, Inc. | IL-21 antagonists |
KR101439828B1 (en) | 2005-11-30 | 2014-09-17 | 애브비 인코포레이티드 | Monoclonal antibodies against amyloid beta protein and uses thereof |
AU2006319358B2 (en) | 2005-11-30 | 2012-01-19 | AbbVie Deutschland GmbH & Co. KG | Anti-Abeta globulomer antibodies, antigen-binding moieties thereof, corresponding hybridomas, nucleic acids, vectors, host cells, methods of producing said antibodies, compositions comprising said antibodies, uses of said antibodies and methods of using said antibodies |
BRPI0619234A2 (en) | 2005-11-30 | 2011-11-08 | Massachusetts Inst Technology | method and apparatus for detecting soluble antigen, method and apparatus for detecting target particles and method for identifying a plant pathogen |
US9829494B2 (en) | 2005-12-01 | 2017-11-28 | Adrenomed Ag | Methods of treatment using ADM antibodies |
US20070237764A1 (en) * | 2005-12-02 | 2007-10-11 | Genentech, Inc. | Binding polypeptides with restricted diversity sequences |
JP5312039B2 (en) | 2005-12-02 | 2013-10-09 | バイオジェン・アイデック・エムエイ・インコーポレイテッド | Treatment of conditions involving demyelination |
PT1960434E (en) | 2005-12-08 | 2012-10-02 | Medarex Inc | Human monoclonal antibodies to fucosyl-gm1 and methods for using anti-fucosyl-gm1 |
DK1960430T3 (en) * | 2005-12-09 | 2015-01-05 | Ucb Pharma Sa | ANTIBODY MOLECULES THAT HAVE SPECIFICITY FOR HUMANT IL-6 |
DOP2006000277A (en) | 2005-12-12 | 2007-08-31 | Bayer Pharmaceuticals Corp | ANTI MN ANTIBODIES AND METHODS FOR USE |
US10183986B2 (en) | 2005-12-15 | 2019-01-22 | Industrial Technology Research Institute | Trimeric collagen scaffold antibodies |
US8014957B2 (en) | 2005-12-15 | 2011-09-06 | Fred Hutchinson Cancer Research Center | Genes associated with progression and response in chronic myeloid leukemia and uses thereof |
US20070264687A1 (en) | 2005-12-15 | 2007-11-15 | Min-Yuan Chou | Recombinant triplex scaffold-based polypeptides |
US7632498B2 (en) | 2005-12-19 | 2009-12-15 | Tripath Imaging, Inc. | MCM6 and MCM7 monoclonal antibodies and methods for their use in the detection of cervical disease |
EP1803814A1 (en) | 2005-12-27 | 2007-07-04 | SIGMA-TAU Industrie Farmaceutiche Riunite S.p.A. | Method of improving the antibody selection capacity in phage-display library |
WO2007074880A1 (en) | 2005-12-28 | 2007-07-05 | Chugai Seiyaku Kabushiki Kaisha | Antibody-containing stabilizing preparation |
EP2025762A3 (en) | 2006-01-17 | 2009-09-30 | Health Research Inc. | Heteroduplex tracking assay |
WO2009051846A2 (en) | 2007-10-18 | 2009-04-23 | Cell Signaling Technology, Inc. | Translocation and mutant ros kinase in human non-small cell lung carcinoma |
US20120208824A1 (en) | 2006-01-20 | 2012-08-16 | Cell Signaling Technology, Inc. | ROS Kinase in Lung Cancer |
JP5184374B2 (en) | 2006-01-25 | 2013-04-17 | エラスムス・ユニヴァーシティ・メディカル・センター・ロッテルダム | Allele exclusion |
EP1990060B1 (en) | 2006-01-27 | 2016-09-28 | Keio University | Therapeutic agents for diseases associated involving choroidal neovascularization |
CN103215293B (en) | 2006-01-27 | 2015-10-28 | 比奥根Ma公司 | NOGO receptor antagonist |
WO2007090076A2 (en) | 2006-01-27 | 2007-08-09 | Tripath Imaging, Inc. | Methods for identifying patients with an increased likelihood of having ovarian cancer and compositions therefor |
EP1987361A4 (en) * | 2006-01-30 | 2009-03-04 | Invitrogen Corp | Compositions and methods for detecting and quantifying toxic substances in disease states |
US20070175313A1 (en) * | 2006-01-31 | 2007-08-02 | Kevin Vandervliet | MP3 player holder assembly |
EA017417B1 (en) * | 2006-02-01 | 2012-12-28 | Сефалон Астралия Пти Лтд. | DOMAIN ANTIBODY CONSTRUCT WHICH BINDS TO HUMAN TNF-α AND USE THEREOF |
WO2007120975A2 (en) | 2006-02-13 | 2007-10-25 | The Government Of The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Variants in complement regulatory genes predict age-related macular degeneration |
US7704953B2 (en) * | 2006-02-17 | 2010-04-27 | Mdrna, Inc. | Phage displayed cell binding peptides |
TWI417301B (en) | 2006-02-21 | 2013-12-01 | Wyeth Corp | Antibodies against human il-22 and uses therefor |
TW200744634A (en) | 2006-02-21 | 2007-12-16 | Wyeth Corp | Methods of using antibodies against human IL-22 |
EP2514824A3 (en) | 2006-03-03 | 2013-01-23 | Amorfix Life Sciences Ltd. | Methods and compositions to treat and detect misfolded-SOD1 mediated diseases |
EP2540741A1 (en) | 2006-03-06 | 2013-01-02 | Aeres Biomedical Limited | Humanized anti-CD22 antibodies and their use in treatment of oncology, transplantation and autoimmune disease |
EP2010569A4 (en) | 2006-03-20 | 2009-09-09 | Xoma Technology Ltd | Human antibodies specific for gastrin materials and methods |
CN103641915B (en) | 2006-03-27 | 2017-04-12 | 医学免疫有限公司 | Binding member for GM-CSF receptor |
CA2646048A1 (en) | 2006-03-30 | 2007-11-08 | Novartis Ag | Compositions and methods of use for antibodies of c-met |
DK3056568T3 (en) | 2006-03-31 | 2021-11-01 | Chugai Pharmaceutical Co Ltd | PROCEDURES FOR CONTROL OF THE BLOOD PHARMACOKINETICS OF ANTIBODIES |
ES2654040T3 (en) | 2006-03-31 | 2018-02-12 | Chugai Seiyaku Kabushiki Kaisha | Antibody modification method for the purification of bispecific antibodies |
CA2638774C (en) | 2006-03-31 | 2015-11-24 | Medarex, Inc. | Transgenic animals expressing chimeric antibodies for use in preparing human antibodies |
AR059922A1 (en) | 2006-04-01 | 2008-05-07 | Galaxy Biotech Llc | HUMANIZED MONOCLONAL ANTIBODIES FOR THE GROWTH FACTOR OF HEPATOCITS |
NZ611859A (en) | 2006-04-05 | 2014-12-24 | Abbvie Biotechnology Ltd | Antibody purification |
WO2007116962A1 (en) | 2006-04-07 | 2007-10-18 | Osaka University | Muscle regeneration promoter |
KR20090029184A (en) | 2006-04-07 | 2009-03-20 | 더 가브먼트 오브 더 유나이티드 스테이츠 오브 아메리카, 리프리젠티드 바이 더 세크러테리, 디파트먼트 오브 헬쓰 앤드 휴먼 서비씨즈 | Antibody compositions and methods for treatment of neoplastic disease |
EP2666478A3 (en) | 2006-04-10 | 2014-10-22 | AbbVie Biotechnology Ltd | Uses and compositions for treatment of psoriasis |
CA2564435A1 (en) | 2006-04-10 | 2007-10-10 | Abbott Biotechnology Ltd. | Methods for monitoring and treating intestinal disorders |
US9624295B2 (en) | 2006-04-10 | 2017-04-18 | Abbvie Biotechnology Ltd. | Uses and compositions for treatment of psoriatic arthritis |
EP2011870A4 (en) | 2006-04-14 | 2010-09-15 | Medical & Biol Lab Co Ltd | Mutant polypeptide having effector function |
US8784810B2 (en) | 2006-04-18 | 2014-07-22 | Janssen Alzheimer Immunotherapy | Treatment of amyloidogenic diseases |
TWI395754B (en) | 2006-04-24 | 2013-05-11 | Amgen Inc | Humanized c-kit antibody |
US20090298093A1 (en) * | 2006-04-27 | 2009-12-03 | Roberto Polakiewicz | Reagents for the Detection of Protein Phosphorylation in ATM & ATR Kinase Signaling Pathways |
US10522240B2 (en) | 2006-05-03 | 2019-12-31 | Population Bio, Inc. | Evaluating genetic disorders |
US7702468B2 (en) | 2006-05-03 | 2010-04-20 | Population Diagnostics, Inc. | Evaluating genetic disorders |
WO2007130520A2 (en) | 2006-05-04 | 2007-11-15 | Abmaxis Inc. | Cross-species and multi-species display systems |
CA2651567A1 (en) * | 2006-05-09 | 2007-11-22 | Genentech, Inc. | Binding polypeptides with optimized scaffolds |
AU2007249160B2 (en) | 2006-05-15 | 2013-09-12 | I2 Pharmaceuticals, Inc. | Neutralizing antibodies to influenza viruses |
GB0611116D0 (en) | 2006-06-06 | 2006-07-19 | Oxford Genome Sciences Uk Ltd | Proteins |
CN101500608A (en) | 2006-06-08 | 2009-08-05 | 中外制药株式会社 | Preventive or remedy for inflammatory disease |
SG177907A1 (en) | 2006-06-14 | 2012-02-28 | Macrogenics Inc | Methods for the treatment of autoimmune disorders using immunosuppressive monoclonal antibodies with reduced toxicity |
JP5597793B2 (en) * | 2006-06-19 | 2014-10-01 | メルク・シャープ・アンド・ドーム・コーポレーション | ILT3-binding molecules and uses thereof |
CA2743725A1 (en) | 2006-06-23 | 2007-12-27 | Aegis Therapeutics, Llc | Stabilizing alkylglycoside compositions and methods thereof |
LT2029173T (en) | 2006-06-26 | 2016-11-10 | Macrogenics, Inc. | Fc riib-specific antibodies and methods of use thereof |
US7572618B2 (en) | 2006-06-30 | 2009-08-11 | Bristol-Myers Squibb Company | Polynucleotides encoding novel PCSK9 variants |
TWI498137B (en) | 2006-06-30 | 2015-09-01 | Abbvie Biotechnology Ltd | Automatic injection device |
WO2008005429A2 (en) | 2006-07-03 | 2008-01-10 | Charles David Adair | Composition for modulating the expression of cell adhesion molecules |
TWI369402B (en) | 2006-07-05 | 2012-08-01 | Catalyst Biosciences Inc | Protease screening methods and proteases identified thereby |
TW200808351A (en) | 2006-07-13 | 2008-02-16 | Chugai Pharmaceutical Co Ltd | Cell death-inducing agents |
CN101622276B (en) * | 2006-07-18 | 2015-04-22 | 赛诺菲-安万特 | Antagonist antibody against EphA2 for the treatment of cancer |
JP5175729B2 (en) | 2006-07-21 | 2013-04-03 | 中外製薬株式会社 | Kidney disease treatment |
RU2009107494A (en) | 2006-08-04 | 2010-09-10 | Астразенека Аб (Se) | ANTIBODIES TO ErbB2 |
CA2659820A1 (en) | 2006-08-04 | 2008-02-14 | Novartis Ag | Ephb3-specific antibody and uses thereof |
ES2506065T3 (en) | 2006-08-11 | 2014-10-13 | Csl Limited | Treatment of pulmonary pathological conditions |
US7939636B2 (en) | 2006-08-11 | 2011-05-10 | Cell Signaling Technology, Inc. | Reagents for the detection of protein phosphorylation in c-Src signaling pathways |
WO2008018641A1 (en) | 2006-08-11 | 2008-02-14 | Ono Pharmaceutical Co., Ltd. | Monoclonal antibodies against stromal derived factor-1 (sdf-1) |
WO2008020586A1 (en) | 2006-08-14 | 2008-02-21 | Forerunner Pharma Research Co., Ltd. | Diagnosis and treatment of cancer using anti-desmoglein-3 antibody |
GEP20125612B (en) | 2006-08-18 | 2012-08-27 | Novartis Ag | Prlr-specific antibody and usage thereof |
EP2057271A2 (en) | 2006-08-22 | 2009-05-13 | University of Copenhagen | Flavin monooxygenases and transcription factors involved in glucosinolate biosynthesis |
EP2064243A2 (en) | 2006-08-28 | 2009-06-03 | Kyowa Hakko Kirin Co., Ltd. | Antagonistic human light-specific human monoclonal antibodies |
US20090258442A1 (en) * | 2006-08-31 | 2009-10-15 | Cell Signaling Technology, Inc. | Reagents for the detection of protein phosphorylation in carcinoma signaling pathways |
GB0617429D0 (en) | 2006-09-05 | 2006-10-18 | Electrophoretics Ltd | Markers of renal transplant rejection and renal damage |
US20110182904A1 (en) | 2006-09-05 | 2011-07-28 | Deborah Zimmerman | Antibodies to bone morphogenic proteins and receptors therefor and methods for their use |
ES2902063T3 (en) | 2006-09-08 | 2022-03-24 | Abbvie Bahamas Ltd | Interleukin-13 binding proteins |
US20100297103A1 (en) | 2006-09-14 | 2010-11-25 | Medical & Biological Laboratories Co., Ltd. | Antibody having enhanced adcc activity and method for production thereof |
US9040050B2 (en) | 2006-09-26 | 2015-05-26 | Genmab A/S | Combination treatment of CD38-expressing tumors |
EP2067045B1 (en) | 2006-09-28 | 2020-08-05 | The Macfarlane Burnet Institute for Medical Research and Public Health Limited | Method for determining the cd4+ t-cell count and kit therefor |
SG178712A1 (en) | 2006-10-02 | 2012-03-29 | Medarex Inc | Human antibodies that bind cxcr4 and uses thereof |
AU2007312367B2 (en) | 2006-10-12 | 2012-09-06 | Chugai Seiyaku Kabushiki Kaisha | Diagnosis and treatment of cancer using anti-EREG antibody |
MX2009003774A (en) | 2006-10-12 | 2009-04-22 | Genentech Inc | Antibodies to lymphotoxin-alpha. |
EP2076287A2 (en) | 2006-10-12 | 2009-07-08 | Wyeth | Methods and compositions with reduced opalescence |
JP2010506842A (en) | 2006-10-16 | 2010-03-04 | メディミューン,エルエルシー | Molecules with reduced half-life, compositions thereof and uses |
GB0620729D0 (en) | 2006-10-18 | 2006-11-29 | Ucb Sa | Biological products |
WO2008060813A2 (en) | 2006-10-19 | 2008-05-22 | Merck & Co., Inc. | High affinity antibody antagonists of interleukin-13 receptor alpha 1 |
EP1914242A1 (en) | 2006-10-19 | 2008-04-23 | Sanofi-Aventis | Novel anti-CD38 antibodies for the treatment of cancer |
ES2388567T3 (en) | 2006-10-19 | 2012-10-16 | Csl Limited | Anti-il-13r alpha 1 antibodies and uses thereof |
CN101589058A (en) | 2006-10-20 | 2009-11-25 | 株式会社未来创药研究所 | Cancer therapeutic agent comprising anti-HB-EGF antibody as active ingredient |
EP2078731A4 (en) | 2006-10-20 | 2012-08-01 | Forerunner Pharma Res Co Ltd | Pharmaceutical composition comprising anti-hb-egf antibody as active ingredient |
US7846434B2 (en) | 2006-10-24 | 2010-12-07 | Trubion Pharmaceuticals, Inc. | Materials and methods for improved immunoglycoproteins |
MX2009004519A (en) | 2006-11-03 | 2009-05-12 | Wyeth Corp | Glycolysis-inhibiting substances in cell culture. |
EP1921142A1 (en) * | 2006-11-07 | 2008-05-14 | Cytos Biotechnology AG | Selection of human monoclonal antibodies by eukaryotic cell display |
CN101573381A (en) | 2006-11-09 | 2009-11-04 | Irm责任有限公司 | Agonist TrkB antibodies and uses thereof |
WO2008063933A2 (en) | 2006-11-10 | 2008-05-29 | Massachusetts Institute Of Technology | Pak modulators |
MX2009005189A (en) | 2006-11-15 | 2009-06-30 | Medarex Inc | Human monoclonal antibodies to btla and methods of use. |
EP2094282A4 (en) | 2006-11-15 | 2010-05-05 | Functional Genetics Inc | Anti-tsg101 antibodies and their uses for treatment of viral infections |
WO2008064306A2 (en) | 2006-11-22 | 2008-05-29 | Curedm, Inc. | Methods and compositions relating to islet cell neogenesis |
US7488807B2 (en) | 2006-11-22 | 2009-02-10 | 3M Innovative Properties Company | Antibody with protein A selectivity |
EP2431053A1 (en) | 2006-11-27 | 2012-03-21 | Patrys Limited | Novel glycosylated peptide target in neoplastic cells |
TW200831528A (en) | 2006-11-30 | 2008-08-01 | Astrazeneca Ab | Compounds |
US8455626B2 (en) | 2006-11-30 | 2013-06-04 | Abbott Laboratories | Aβ conformer selective anti-aβ globulomer monoclonal antibodies |
MX2009005776A (en) | 2006-12-01 | 2009-06-10 | Medarex Inc | Human antibodies that bind cd22 and uses thereof. |
WO2008069999A2 (en) | 2006-12-01 | 2008-06-12 | Selexys Pharmaceuticals Corporation | Anti-p-selectin antibodies and methods of using the same to treat inflammatory diseases |
US8455622B2 (en) | 2006-12-01 | 2013-06-04 | Seattle Genetics, Inc. | Variant target binding agents and uses thereof |
AU2007330306B2 (en) | 2006-12-05 | 2013-10-24 | Decode Genetics Ehf. | Genetic markers for risk management of cardiac arrhythmia |
EP2687232A1 (en) | 2006-12-06 | 2014-01-22 | MedImmune, LLC | Methods of treating systemic lupus erythematosus |
WO2008070780A1 (en) | 2006-12-07 | 2008-06-12 | Novartis Ag | Antagonist antibodies against ephb3 |
US20080139790A1 (en) * | 2006-12-08 | 2008-06-12 | Jennings Philip A | Chimeric antibodies |
US8680252B2 (en) | 2006-12-10 | 2014-03-25 | Dyadic International (Usa), Inc. | Expression and high-throughput screening of complex expressed DNA libraries in filamentous fungi |
US9862956B2 (en) | 2006-12-10 | 2018-01-09 | Danisco Us Inc. | Expression and high-throughput screening of complex expressed DNA libraries in filamentous fungi |
CL2007003622A1 (en) | 2006-12-13 | 2009-08-07 | Medarex Inc | Human anti-cd19 monoclonal antibody; composition comprising it; and tumor cell growth inhibition method. |
WO2008074004A2 (en) | 2006-12-14 | 2008-06-19 | Medarex, Inc. | Human antibodies that bind cd70 and uses thereof |
EP2103628A4 (en) | 2006-12-14 | 2012-02-22 | Forerunner Pharma Res Co Ltd | Anti-claudin-3 monoclonal antibody, and treatment and diagnosis of cancer using the same |
US7935791B2 (en) | 2006-12-18 | 2011-05-03 | Genentech, Inc. | Antagonist anti-Notch3 antibodies and their use in the prevention and treatment of Notch3-related diseases |
RU2554747C9 (en) | 2006-12-20 | 2015-10-20 | Ксома (Сша) Ллс | Method of treating il-1beta-dependent diseases |
US20080171344A1 (en) * | 2006-12-22 | 2008-07-17 | Kapsner Kenneth P | Methods, Kits and Materials for Diagnosing Disease States by Measuring Isoforms or Proforms of Myeloperoxidase |
WO2008083169A2 (en) | 2006-12-26 | 2008-07-10 | The Johns Hopkins University | Compositions and methods for the treatment of immunologic disorders |
US7989173B2 (en) | 2006-12-27 | 2011-08-02 | The Johns Hopkins University | Detection and diagnosis of inflammatory disorders |
CN101663323A (en) | 2006-12-27 | 2010-03-03 | 埃默里大学 | The composition and the method that are used for the treatment of transmissible disease and tumour |
WO2008083239A2 (en) | 2006-12-27 | 2008-07-10 | The Johns Hopkins University | Compositions and methods for stimulating an immune response |
TWI412367B (en) | 2006-12-28 | 2013-10-21 | Medarex Llc | Chemical linkers and cleavable substrates and conjugates thereof |
EP2114443A4 (en) * | 2006-12-29 | 2011-08-10 | Abbott Lab | Dual-specific il-1a/ il-1b antibodies |
EP2123676A4 (en) | 2007-01-05 | 2011-01-05 | Univ Tokyo | Diagnosis and treatment of cancer by using anti-prg-3 antibody |
DK2740744T3 (en) | 2007-01-09 | 2018-04-23 | Biogen Ma Inc | Sp35 antibodies and uses thereof |
US8128926B2 (en) | 2007-01-09 | 2012-03-06 | Biogen Idec Ma Inc. | Sp35 antibodies and uses thereof |
WO2008084402A2 (en) | 2007-01-11 | 2008-07-17 | Philipps-Universitaet Marburg | Diagnosis and treatment of alzheimer's and other neurodementing diseases |
NZ578065A (en) | 2007-01-16 | 2012-09-28 | Abbott Lab | Methods for treating psoriasis with an antibody which binds to an epitope |
TWI438208B (en) | 2007-01-23 | 2014-05-21 | Chugai Pharmaceutical Co Ltd | Agents for suppressing chronic rejection reaction |
WO2008098139A2 (en) | 2007-02-07 | 2008-08-14 | The Regents Of The University Of Colorado | Axl tyrosine kinase inhibitors and methods of making and using the same |
AU2008212117B2 (en) | 2007-02-07 | 2014-09-11 | Decode Genetics Ehf. | Genetic variants contributing to risk of prostate cancer |
CA2676766A1 (en) | 2007-02-09 | 2008-08-21 | Genentech, Inc. | Anti-robo4 antibodies and uses therefor |
AR065368A1 (en) | 2007-02-15 | 2009-06-03 | Astrazeneca Ab | ANTIBODIES FOR IGE MOLECULES |
US8114606B2 (en) * | 2007-02-16 | 2012-02-14 | The Board Of Trustees Of Southern Illinois University | ARL-1 specific antibodies |
PL2716301T3 (en) | 2007-02-16 | 2017-10-31 | Merrimack Pharmaceuticals Inc | Antibodies against erbb3 and uses thereof |
US8685666B2 (en) | 2007-02-16 | 2014-04-01 | The Board Of Trustees Of Southern Illinois University | ARL-1 specific antibodies and uses thereof |
WO2008102380A1 (en) | 2007-02-21 | 2008-08-28 | Decode Genetics Ehf | Genetic susceptibility variants associated with cardiovascular disease |
WO2008103693A2 (en) | 2007-02-21 | 2008-08-28 | Medarex, Inc. | Chemical linkers with single amino acids and conjugates thereof |
DK2118300T3 (en) | 2007-02-23 | 2015-07-13 | Prothena Biosciences Ltd | PREVENTION AND TREATMENT OF SYNUCLEINOPATHIC AND AMYLOIDOGENIC DISEASE |
EP2121745A2 (en) | 2007-02-26 | 2009-11-25 | Oxford Genome Sciences (UK) Limited | Proteins |
WO2008104803A2 (en) | 2007-02-26 | 2008-09-04 | Oxford Genome Sciences (Uk) Limited | Proteins |
WO2008104386A2 (en) | 2007-02-27 | 2008-09-04 | Abbott Gmbh & Co. Kg | Method for the treatment of amyloidoses |
CN101951953A (en) | 2007-02-27 | 2011-01-19 | 株式会社未来创药研究所 | Contain the pharmaceutical composition of anti-GRP78 antibody as effective ingredient |
US20090081659A1 (en) | 2007-03-07 | 2009-03-26 | Cell Signaling Technology, Inc. | Reagents for the detection of protein phosphorylation in carcinoma signaling pathways |
CL2008000719A1 (en) | 2007-03-12 | 2008-09-05 | Univ Tokushima Chugai Seiyaku | THERAPEUTIC AGENT FOR CANCER RESISTANT TO CHEMOTHERAPEUTIC AGENTS THAT UNDERSTAND AN ANTIBODY THAT RECOGNIZES IT CLASS I AS ACTIVE INGREDIENT; PHARMACEUTICAL COMPOSITION THAT INCLUDES SUCH ANTIBODY; AND METHOD TO TREAT CANCER RESISTANT TO |
GB2447786C (en) | 2007-03-22 | 2011-11-09 | Heptares Therapeutics Ltd | Mutant G-protein coupled receptor proteins and methods for selecting them |
NZ580245A (en) | 2007-03-22 | 2012-01-12 | Biogen Idec Inc | Binding proteins, including antibodies, antibody derivatives and antibody fragments, that specifically bind cd154 and uses thereof |
EP1975184A3 (en) | 2007-03-26 | 2008-11-26 | Cell Signaling Technology, Inc. | Serine or threonine phosphorylation sites |
US20080238709A1 (en) * | 2007-03-28 | 2008-10-02 | Faramarz Vaziri | One-way communication apparatus with dynamic key generation |
NZ598881A (en) | 2007-03-29 | 2013-11-29 | Abbvie Inc | Crystalline anti-human il-12 antibodies |
JP5456658B2 (en) | 2007-03-30 | 2014-04-02 | メディミューン,エルエルシー | Antibody preparation |
PA8775101A1 (en) | 2007-04-02 | 2008-11-19 | Pfizer | ANTI-IGE ANTIBODIES |
CN103275220B (en) | 2007-04-02 | 2016-01-20 | 菲洛根股份公司 | The ED-A antigen of the fibronectin relevant with the new vessel of metastases |
US7807168B2 (en) * | 2007-04-10 | 2010-10-05 | Vaccinex, Inc. | Selection of human TNFα specific antibodies |
MX2009010997A (en) | 2007-04-13 | 2009-11-02 | Catalyst Biosciences Inc | Modified factor vii polypetides and uses thereof. |
GB0707505D0 (en) * | 2007-04-18 | 2007-05-30 | Medical Res Council | Antibodies against il-25 |
EP1983003A3 (en) | 2007-04-19 | 2009-03-11 | Peter Hornbeck | Tyrosine phosphorylation sites and antibodies specific for them |
EP1983002A3 (en) | 2007-04-19 | 2009-03-11 | Peter Hornbeck | Tyrosine phosphorylation sites and antibodies specific for them |
US7977462B2 (en) | 2007-04-19 | 2011-07-12 | Cell Signaling Technology, Inc. | Tyrosine phosphorylation sites |
US20090053831A1 (en) | 2007-05-01 | 2009-02-26 | Cell Signaling Technology, Inc. | Tyrosine phosphorylation sites |
EP2164868B1 (en) | 2007-05-04 | 2015-03-25 | Technophage, Investigação E Desenvolvimento Em Biotecnologia, SA | Engineered rabbit antibody variable domains and uses thereof |
RU2549701C2 (en) | 2007-05-07 | 2015-04-27 | Медиммун, Ллк | Anti-icos antibodies and their application in treatment of oncological, transplantation-associated and autoimmune diseases |
EP2068927B1 (en) | 2007-05-14 | 2015-10-21 | MedImmune, LLC | Methods of reducing eosinophil levels |
AU2007353779B2 (en) * | 2007-05-17 | 2013-11-07 | Genentech, Inc. | Crystal structures of neuropilin fragments and neuropilin-antibody complexes |
WO2008146309A2 (en) | 2007-05-25 | 2008-12-04 | Decode Genetics Ehf. | Genetic variants on chr 5pl2 and 10q26 as markers for use in breast cancer risk assessment, diagnosis, prognosis and treatment |
JP5117765B2 (en) | 2007-05-28 | 2013-01-16 | 国立大学法人 東京大学 | Tumor diagnostic agent for PET containing anti-ROBO1 antibody |
US20090232801A1 (en) * | 2007-05-30 | 2009-09-17 | Abbot Laboratories | Humanized Antibodies Which Bind To AB (1-42) Globulomer And Uses Thereof |
PE20090329A1 (en) * | 2007-05-30 | 2009-03-27 | Abbott Lab | HUMANIZED ANTIBODIES AGAINST GLOBULOMER AB (20-42) AND ITS USES |
US7709215B2 (en) | 2007-06-01 | 2010-05-04 | Cytonics Corporation | Method for diagnosing and treating acute joint injury |
GB0724331D0 (en) | 2007-12-13 | 2008-01-23 | Domantis Ltd | Compositions for pulmonary delivery |
KR20100018040A (en) | 2007-06-06 | 2010-02-16 | 도만티스 리미티드 | Methods for selecting protease resistant polypeptides |
US8999337B2 (en) | 2007-06-11 | 2015-04-07 | Abbvie Biotechnology Ltd. | Methods for treating juvenile idiopathic arthritis by inhibition of TNFα |
CA2691075C (en) | 2007-06-15 | 2017-04-11 | Daniela Gast | Treatment of tumors using specific anti-l1 antibody |
ES2591281T3 (en) | 2007-07-12 | 2016-11-25 | Gitr, Inc. | Combination therapies that employ GITR binding molecules |
US8153595B2 (en) | 2007-07-13 | 2012-04-10 | The Johns Hopkins University | B7-DC variants immunogenic compositions and methods of use thereof |
TW200918089A (en) | 2007-07-16 | 2009-05-01 | Genentech Inc | Humanized anti-CD79b antibodies and immunoconjugates and methods of use |
JP5469600B2 (en) | 2007-07-16 | 2014-04-16 | ジェネンテック, インコーポレイテッド | Anti-CD79b antibody and immunoconjugate and method of use thereof |
EP2167541B1 (en) | 2007-07-25 | 2012-12-19 | Philogen S.p.A. | The ed-a antigen of fibronectin is associated with the neovasculature of tumour metastases |
EP2174667B1 (en) | 2007-07-26 | 2017-01-04 | Osaka University | Agent for treatment of ophthalmia containing interleukin-6 receptor inhibitor as active ingredient |
DK2182983T3 (en) | 2007-07-27 | 2014-07-14 | Janssen Alzheimer Immunotherap | TREATMENT OF AMYLOIDOGENIC DISEASES WITH HUMANIZED ANTI-ABETA ANTIBODIES |
MX2010001307A (en) | 2007-08-02 | 2010-07-30 | Novimmune Sa | Anti-rantes antibodies and methods of use thereof. |
JP5659014B2 (en) | 2007-08-02 | 2015-01-28 | ジリード バイオロジクス,インク. | Methods and compositions for treatment and diagnosis of fibrosis, tumor invasion, angiogenesis and metastasis |
WO2009020477A1 (en) * | 2007-08-06 | 2009-02-12 | Yale University | Modified miniature proteins |
US9693539B2 (en) | 2007-08-10 | 2017-07-04 | E. R. Squibb & Sons, L.L.C. | HCO32 and HCO27 and related examples |
WO2009021754A2 (en) | 2007-08-15 | 2009-02-19 | Bayer Schering Pharma Aktiengesellschaft | Monospecific and multispecific antibodies and method of use |
EP2190987B1 (en) | 2007-08-21 | 2012-11-14 | MorphoSys AG | Methods for the formation of disulphide bonds |
EP2185188B1 (en) | 2007-08-22 | 2014-08-06 | Medarex, L.L.C. | Site-specific attachment of drugs or other agents to engineered antibodies with c-terminal extensions |
CA2698203C (en) | 2007-08-29 | 2018-09-11 | Sanofi-Aventis | Humanized anti-cxcr5 antibodies, derivatives thereof and their use |
NZ599756A (en) * | 2007-08-30 | 2013-09-27 | Curedm Group Holdings Llc | Compositions and methods of using proislet peptides and analogs thereof |
PL2199390T3 (en) | 2007-08-30 | 2017-06-30 | Daiichi Sankyo Company, Limited | Anti-epha2 antibody |
US8415455B2 (en) | 2007-09-04 | 2013-04-09 | Compugen Ltd | Polypeptides and polynucleotides, and uses thereof as a drug target for producing drugs and biologics |
GB0717337D0 (en) | 2007-09-06 | 2007-10-17 | Ucb Pharma Sa | Method of treatment |
WO2009033071A2 (en) * | 2007-09-07 | 2009-03-12 | Dyadic International, Inc. | Novel fungal enzymes |
US8877688B2 (en) | 2007-09-14 | 2014-11-04 | Adimab, Llc | Rationally designed, synthetic antibody libraries and uses therefor |
EP2193146B1 (en) * | 2007-09-14 | 2016-05-25 | Adimab, LLC | Rationally designed, synthetic antibody libraries and uses therefor |
CL2008002775A1 (en) | 2007-09-17 | 2008-11-07 | Amgen Inc | Use of a sclerostin binding agent to inhibit bone resorption. |
US9377465B2 (en) | 2007-09-18 | 2016-06-28 | Dako Denmark A/S | Rapid and sensitive method for detection of biological targets |
EP2195341B1 (en) | 2007-09-26 | 2017-03-22 | UCB Biopharma SPRL | Dual specificity antibody fusions |
CN106519025B (en) | 2007-09-26 | 2021-04-23 | 中外制药株式会社 | Method for changing isoelectric point of antibody by using amino acid substitution of CDR |
EP2205280B1 (en) | 2007-09-27 | 2019-09-04 | Amgen Inc. | Pharmaceutical formulations |
AU2008305851B2 (en) | 2007-09-28 | 2014-12-18 | Chugai Seiyaku Kabushiki Kaisha | Anti-glypican-3 antibody having improved kinetics in plasma |
EP2196220B1 (en) | 2007-10-02 | 2014-12-03 | Chugai Seiyaku Kabushiki Kaisha | Inhibting anti-IL-6 receptor antibody for treating graft-versus-host disease |
US8470560B2 (en) | 2007-10-03 | 2013-06-25 | The United States Of America As Represented By The Secretary Of The Army | CR-2 binding peptide P28 as molecular adjuvant for DNA vaccines |
EP2205971A4 (en) * | 2007-10-04 | 2011-03-30 | Bionomics Ltd | Markers of endothelial cells and uses thereof |
WO2009048072A1 (en) | 2007-10-11 | 2009-04-16 | Daiichi Sankyo Company, Limited | ANTIBODY TARGETING OSTEOCLAST-RELATED PROTEIN Siglec-15 |
AR068767A1 (en) | 2007-10-12 | 2009-12-02 | Novartis Ag | ANTIBODIES AGAINST SCLEROSTIN, COMPOSITIONS AND METHODS OF USE OF THESE ANTIBODIES TO TREAT A PATHOLOGICAL DISORDER MEDIATIONED BY SCLEROSTIN |
EP2050764A1 (en) | 2007-10-15 | 2009-04-22 | sanofi-aventis | Novel polyvalent bispecific antibody format and uses thereof |
US9683027B2 (en) | 2007-10-15 | 2017-06-20 | Chugai Seiyaku Kabushiki Kaisha | Method for production of antibody |
JO3076B1 (en) | 2007-10-17 | 2017-03-15 | Janssen Alzheimer Immunotherap | Immunotherapy regimes dependent on apoe status |
US20100297115A1 (en) | 2007-10-23 | 2010-11-25 | Novartis Ag | Use of trkb antibodies for the treatment of respiratory disorders |
JP5620106B2 (en) | 2007-10-24 | 2014-11-05 | 株式会社糖鎖工学研究所 | Polypeptide having enhanced effector function |
WO2009055656A2 (en) | 2007-10-26 | 2009-04-30 | Centocor, Inc. | Vectors, host cells, and methods of production and uses |
EP2209805B1 (en) | 2007-10-30 | 2017-09-06 | Philogen S.p.A. | An antigen associated with rheumatoid arthritis |
EP2851432B1 (en) | 2007-11-01 | 2019-01-09 | University of Iowa Research Foundation | RCA locus analysis to assess susceptibility to AMD |
PE20091163A1 (en) | 2007-11-01 | 2009-08-09 | Wyeth Corp | ANTIBODIES FOR GDF8 |
DK2567709T3 (en) | 2007-11-02 | 2018-03-12 | Novartis Ag | Molecules and Methods for Modulating Low-Density Lipoprotein Receptor-Related Protein 6 (LRP6) |
AU2008324800B2 (en) | 2007-11-05 | 2014-03-27 | Astrazeneca Ab | Methods of treating scleroderma |
NZ585556A (en) | 2007-11-07 | 2012-07-27 | Celldex Therapeutics Inc | Antibodies that bind human dendritic and epithelial cell 205 (dec-205) |
US8680243B2 (en) | 2007-11-14 | 2014-03-25 | Chugai Seiyaku Kabushiki Kaisha | Diagnosis and treatment of cancer using anti-GPR49 antibody |
BRPI0820543A2 (en) | 2007-11-15 | 2015-06-16 | Chugai Pharmaceutical Co Ltd | Monoclonal antibody capable of binding to annexelekto, and use of it |
WO2009064838A1 (en) | 2007-11-15 | 2009-05-22 | Amgen, Inc. | Aqueous formulation of erythropoiesis stimulating protein stablised by antioxidants for parenteral administration |
JP5580205B2 (en) | 2007-11-19 | 2014-08-27 | セレラ コーポレーション | Lung cancer markers and their use |
CL2008003449A1 (en) | 2007-11-21 | 2010-02-19 | Imclone Llc | Antibody or fragments thereof against the macrophage / rum stimulating protein receptor; pharmaceutical composition comprising it; use to inhibit angiogenesis, tumor growth, proliferation, migration and invasion of tumor cells, activation of rum or phosphorylation of mapk and / or akt; and use to treat cancer. |
EP2062920A3 (en) | 2007-11-21 | 2009-06-17 | Peter Hornbeck | Protein phosphorylation by basophilic serine/threonine kinases in insulin signalling pathways |
JP5490714B2 (en) * | 2007-11-28 | 2014-05-14 | メディミューン,エルエルシー | Protein preparation |
AR069501A1 (en) * | 2007-11-30 | 2010-01-27 | Genentech Inc | ANTI-VEGF ANTIBODIES (VASCULAR ENDOTELIAL GROWTH FACTOR) |
TW200944231A (en) | 2007-11-30 | 2009-11-01 | Glaxo Group Ltd | Antigen-binding constructs |
US8697360B2 (en) | 2007-11-30 | 2014-04-15 | Decode Genetics Ehf. | Genetic variants on CHR 11Q and 6Q as markers for prostate and colorectal cancer predisposition |
MY185647A (en) | 2007-12-05 | 2021-05-27 | Chugai Pharmaceutical Co Ltd | Therapeutic agent for pruritus |
BRPI0821110B8 (en) | 2007-12-05 | 2021-05-25 | Chugai Pharmaceutical Co Ltd | anti-nr10/il31ra neutralizing antibody, pharmaceutical composition comprising said antibody and use thereof |
GB0724051D0 (en) | 2007-12-08 | 2008-01-16 | Medical Res Council | Mutant proteins and methods for producing them |
US20110262425A1 (en) | 2007-12-12 | 2011-10-27 | National Cancer Center | Therapeutic agent for mll leukemia and moz leukemia of which molecular target is m-csf receptor, and use thereof |
CN105001333B (en) | 2007-12-14 | 2019-05-17 | 诺沃—诺迪斯克有限公司 | Anti-human NKG2D antibody and application thereof |
CN101918447B (en) | 2007-12-14 | 2014-06-11 | 布里斯托尔-米尔斯·斯奎布公司 | Binding molecules to the human OX40 receptor |
US8779088B2 (en) | 2007-12-17 | 2014-07-15 | Marfl Ab | Vaccine for the treatment of Mycobacterium related disorders |
GB0724860D0 (en) | 2007-12-20 | 2008-01-30 | Heptares Therapeutics Ltd | Screening |
PT2391650E (en) | 2007-12-20 | 2015-01-14 | Xoma Us Llc | Methods for the treatment of gout |
US8414893B2 (en) | 2007-12-21 | 2013-04-09 | Amgen Inc. | Anti-amyloid antibodies and uses thereof |
US8092804B2 (en) | 2007-12-21 | 2012-01-10 | Medimmune Limited | Binding members for interleukin-4 receptor alpha (IL-4Rα)-173 |
RU2490278C2 (en) | 2007-12-21 | 2013-08-20 | Медиммун Лимитед | ELEMENT BOUND WITH INTERLEUKIN-4 RECEPTOR α (IL-4Rα)-173 |
CA2710680C (en) | 2007-12-26 | 2018-10-16 | Vaccinex, Inc. | Anti-c35 antibody combination therapies and methods |
PE20091174A1 (en) | 2007-12-27 | 2009-08-03 | Chugai Pharmaceutical Co Ltd | LIQUID FORMULATION WITH HIGH CONCENTRATION OF ANTIBODY CONTENT |
ES2544679T3 (en) | 2007-12-28 | 2015-09-02 | Prothena Biosciences Limited | Treatment and prophylaxis of amyloidosis |
GB0800277D0 (en) | 2008-01-08 | 2008-02-13 | Imagination Tech Ltd | Video motion compensation |
CN101918555B (en) | 2008-01-11 | 2013-11-06 | 株式会社遗传科技 | Humanized anti-alpha9 integrin antibodies and the uses thereof |
EP3064512B1 (en) | 2008-01-11 | 2023-08-30 | The University of Tokyo | Anti-cldn6 antibody |
AU2009205995B2 (en) | 2008-01-18 | 2014-04-03 | Medimmune, Llc | Cysteine engineered antibodies for site-specific conjugation |
AU2009206306B2 (en) | 2008-01-25 | 2013-06-06 | Amgen Inc. | Ferroportin antibodies and methods of use |
BRPI0907648B1 (en) | 2008-01-29 | 2022-01-11 | Institute Of Molecular Biology And Genetics National Academy Of Science Of Ukraine | ISOLATED HUMANIZED ANTIBODY, USES OF AN ANTIBODY, METHODS FOR PREPARING AN ANTIBODY, FOR GENERATING IMMUNOREATIVE ANTIBODIES WITH SLC34A2, AND FOR SCREENING OR IDENTIFYING AGENTS OR COMPOUNDS THAT MODULATE SLC34A2, COMPOSITIONS, ISOLATED NUCLEIC ACID, AND, HOST MICROORGANISM |
SI2657253T1 (en) | 2008-01-31 | 2017-10-30 | Genentech, Inc. | Anti-CD79b antibodies and immunoconjugates and methods of use |
US8039596B2 (en) | 2008-02-05 | 2011-10-18 | Bristol-Myers Squibb Company | Alpha 5-beta 1 antibodies and their uses |
CN101952454B (en) | 2008-02-08 | 2014-06-04 | 米迪缪尼有限公司 | Anti-IFNAR1 antibodies with reduced Fc ligand affinity |
GB0802474D0 (en) | 2008-02-11 | 2008-03-19 | Heptares Therapeutics Ltd | Mutant proteins and methods for selecting them |
US8828657B2 (en) | 2008-02-14 | 2014-09-09 | Decode Genetics Ehf. | Susceptibility variants for lung cancer |
AU2009219358A1 (en) | 2008-02-28 | 2009-09-03 | 3M Innovative Properties Company | Antibodies to Clostridium difficile spores and uses thereof |
US20090220991A1 (en) * | 2008-02-29 | 2009-09-03 | Cell Signaling Technology, Inc. | Reagents for the detection of protein phosphorylation in leukemia signaling pathways |
US8962803B2 (en) | 2008-02-29 | 2015-02-24 | AbbVie Deutschland GmbH & Co. KG | Antibodies against the RGM A protein and uses thereof |
EP2098536A1 (en) | 2008-03-05 | 2009-09-09 | 4-Antibody AG | Isolation and identification of antigen- or ligand-specific binding proteins |
EP2268672A1 (en) | 2008-03-12 | 2011-01-05 | Imclone LLC | Anti-tyrp1 antibodies |
US9873957B2 (en) * | 2008-03-13 | 2018-01-23 | Dyax Corp. | Libraries of genetic packages comprising novel HC CDR3 designs |
BR122012027456A2 (en) | 2008-03-14 | 2015-07-14 | Allergan Inc | Pharmaceutical composition comprising botulinum neurotoxin serotype a |
NZ587765A (en) | 2008-03-18 | 2013-02-22 | Abbott Lab | Methods for treating psoriasis |
EP2260102A1 (en) | 2008-03-25 | 2010-12-15 | Novartis Forschungsstiftung, Zweigniederlassung Friedrich Miescher Institute For Biomedical Research | Treating cancer by down-regulating frizzled-4 and/or frizzled-1 |
JP2011516423A (en) | 2008-03-28 | 2011-05-26 | シー レーン バイオテクノロジーズ, エルエルシー | Neutralizing molecules against viral antigens |
EP2631302A3 (en) | 2008-03-31 | 2014-01-08 | Genentech, Inc. | Compositions and methods for treating and diagnosing asthma |
NZ588905A (en) | 2008-04-01 | 2012-08-31 | Decode Genetics Ehf | Genetic testing method for determining susceptibility to abdominal aortic aneurysm by assay for selected polymorphisms associated with the disease |
WO2009123894A2 (en) | 2008-04-02 | 2009-10-08 | Macrogenics, Inc. | Her2/neu-specific antibodies and methods of using same |
ES2654937T3 (en) | 2008-04-02 | 2018-02-15 | Macrogenics, Inc. | Specific antibodies for the BCR complex and procedures for their use |
CL2009000647A1 (en) | 2008-04-04 | 2010-06-04 | Chugai Pharmaceutical Co Ltd | Pharmaceutical composition for treating or preventing liver cancer comprising a combination of a chemotherapeutic agent and an anti-glypican 3 antibody; agent for attenuating a side effect comprising said antibody; method of treating or preventing liver cancer of a subject. |
EP2274437B1 (en) | 2008-04-10 | 2015-12-23 | Cell Signaling Technology, Inc. | Compositions and methods for detecting egfr mutations in cancer |
KR102469853B1 (en) | 2008-04-11 | 2022-11-22 | 추가이 세이야쿠 가부시키가이샤 | Antigen-binding molecule capable of binding to two or more antigen molecules repeatedly |
DK2276509T3 (en) | 2008-04-11 | 2016-09-19 | Seattle Genetics Inc | DETECTION AND TREATMENT OF CANCER IN PANCREAS, ovarian and other cancers |
EP2288715B1 (en) | 2008-04-11 | 2014-09-24 | Merrimack Pharmaceuticals, Inc. | Human serum albumin linkers and conjugates thereof |
GB0807413D0 (en) | 2008-04-23 | 2008-05-28 | Ucb Pharma Sa | Biological products |
EP2281078B1 (en) | 2008-04-24 | 2014-10-22 | Dyax Corporation | Libraries of genetic packages comprising novel hc cdr1, cdr2, and cdr3 and novel lc cdr1, cdr2, and cdr3 designs |
WO2009131256A1 (en) | 2008-04-24 | 2009-10-29 | Gene Techno Science Co., Ltd. | Humanized antibodies specific for amino acid sequence rgd of an extracellular matrix protein and the uses thereof |
CA2722082C (en) | 2008-04-25 | 2021-11-09 | Christopher Tenhoor | Fc receptor binding proteins |
US20090269786A1 (en) * | 2008-04-25 | 2009-10-29 | The Board Of Trustees Of The University Of Illinois | RHO1-Gamma Amino Butyric Acid C Receptor-Specific Antibodies |
SG190572A1 (en) | 2008-04-29 | 2013-06-28 | Abbott Lab | Dual variable domain immunoglobulins and uses thereof |
US8236319B2 (en) | 2008-04-30 | 2012-08-07 | Immunogen, Inc. | Cross-linkers and their uses |
EP2816059A1 (en) | 2008-05-01 | 2014-12-24 | Amgen, Inc | Anti-hepcidin antibodies and methods of use |
ES2458541T3 (en) | 2008-05-02 | 2014-05-06 | Seattle Genetics, Inc. | Methods and compositions for making antibodies and antibody derivatives with reduced core fucosylation |
CN102170903B (en) | 2008-05-02 | 2016-04-06 | 亮点医疗有限公司 | For product and the method for immune response stimulating |
MY159667A (en) | 2008-05-09 | 2017-01-13 | Abbvie Inc | Antibodies to receptor of advanced glycation end products (rage) and uses thereof |
SG176464A1 (en) | 2008-05-09 | 2011-12-29 | Agency Science Tech & Res | Diagnosis and treatment of kawasaki disease |
JP6219556B2 (en) * | 2008-05-16 | 2017-10-25 | ジェネンテック, インコーポレイテッド | Use of biomarkers for evaluation of treatment of gastrointestinal inflammatory disorders using beta7 integrin antagonists |
US20090291073A1 (en) * | 2008-05-20 | 2009-11-26 | Ward Keith W | Compositions Comprising PKC-theta and Methods for Treating or Controlling Ophthalmic Disorders Using Same |
EP2304439A4 (en) | 2008-05-29 | 2012-07-04 | Nuclea Biotechnologies Llc | Anti-phospho-akt antibodies |
WO2009148928A1 (en) | 2008-05-29 | 2009-12-10 | Galaxy Biotech, Llc | Monoclonal antibodies to basic fibroblast growth factor |
AR071891A1 (en) | 2008-05-30 | 2010-07-21 | Imclone Llc | ANTI-FLT3 HUMAN ANTIBODIES (THIROSINE KINASE 3 RECEPTOR HUMAN FMS TYPE) |
US9226934B2 (en) | 2008-06-02 | 2016-01-05 | The University Of Tokyo | Anti-cancer drug |
RU2010153578A (en) | 2008-06-03 | 2012-07-20 | Эбботт Лэборетриз (Us) | IMMUNOGLOBULINS WITH DOUBLE VARIABLE DOMAINS AND THEIR APPLICATION |
CA2726087A1 (en) | 2008-06-03 | 2009-12-10 | Tariq Ghayur | Dual variable domain immunoglobulins and uses thereof |
WO2010033279A2 (en) | 2008-06-04 | 2010-03-25 | Macrogenics, Inc. | Antibodies with altered binding to fcrn and methods of using same |
CA2728243C (en) | 2008-06-05 | 2020-03-10 | National Cancer Center | Il-6 inhibitor for suppressing neuroinvasion in pancreatic cancer |
ES2595362T3 (en) | 2008-06-16 | 2016-12-29 | Patrys Limited | LM antibodies, functional fragments, LM-1 target antigen and methods to prepare and use them |
EP2319869B1 (en) | 2008-06-20 | 2016-08-17 | National University Corporation Okayama University | ANTIBODY AGAINST OXIDIZED LDL/ß²GPI COMPLEX AND USE OF THE SAME |
KR20110036608A (en) | 2008-07-07 | 2011-04-07 | 디코드 제네틱스 이에이치에프 | Genetic variants for breast cancer risk assessment |
TW201014602A (en) | 2008-07-08 | 2010-04-16 | Abbott Lab | Prostaglandin E2 binding proteins and uses thereof |
MY155603A (en) | 2008-07-08 | 2015-11-13 | Oncomed Pharm Inc | Notch-binding agents and antagonists and methods of use thereof |
RU2011104348A (en) | 2008-07-08 | 2012-08-20 | Эбботт Лэборетриз (Us) | IMMUNOGLOBULINS WITH DOUBLE VARIABLE DOMAIN AGAINST PROSTAGLANDINE E2 AND THEIR APPLICATION |
US8834875B2 (en) | 2010-01-13 | 2014-09-16 | Oncomed Pharmaceuticals, Inc. | Notch1 binding agents and methods of use thereof |
DK2982695T3 (en) | 2008-07-09 | 2019-05-13 | Biogen Ma Inc | COMPOSITIONS CONCERNING ANTIBODIES AGAINST LINGO OR FRAGMENTS THEREOF |
US8148088B2 (en) * | 2008-07-18 | 2012-04-03 | Abgent | Regulation of autophagy pathway phosphorylation and uses thereof |
EP2321352B1 (en) | 2008-07-18 | 2016-01-06 | Bristol-Myers Squibb Company | Compositions monovalent for cd28 binding and methods of use |
US20100173828A1 (en) * | 2008-07-25 | 2010-07-08 | Abbott Gmbh & Co. Kg | Aß(X - 38 .. 43) oligomers, and processes, compositions, and uses thereof |
EP2316030B1 (en) | 2008-07-25 | 2019-08-21 | Wagner, Richard W. | Protein screeing methods |
EA027575B1 (en) | 2008-08-05 | 2017-08-31 | Новартис Аг | Antibody or antigen binding fragment thereof, binding human c5 protein, composition comprising same, nucleic acid encoding antibody or antigen binding fragment thereof, vector and host cell comprising said acid, and use of antibody or antigen binding fragment thereof |
WO2010016806A1 (en) | 2008-08-08 | 2010-02-11 | Agency For Science, Technology And Research (A*Star) | Vhz for diagnosis and treatment of cancers |
AR072999A1 (en) | 2008-08-11 | 2010-10-06 | Medarex Inc | HUMAN ANTIBODIES THAT JOIN GEN 3 OF LYMPHOCYTARY ACTIVATION (LAG-3) AND THE USES OF THESE |
US8563697B2 (en) | 2008-08-14 | 2013-10-22 | Cephalon Australia Pty. Ltd. | Anti-IL-12/IL-23 antibodies |
CA3059768A1 (en) | 2008-09-05 | 2010-03-11 | President And Fellows Of Harvard College | Continuous directed evolution of proteins and nucleic acids |
CA2735433C (en) | 2008-09-07 | 2016-02-16 | Glyconex Inc. | Anti-extended type i glycosphingolipid antibody, derivatives thereof and use |
US9075065B2 (en) | 2008-09-12 | 2015-07-07 | Dako Denmark A/S | Prostate cancer biomarker |
CA2739357A1 (en) | 2008-09-23 | 2010-04-08 | Wyeth Llc | Methods for predicting production of activating signals by cross-linked binding proteins |
EP2352841A2 (en) | 2008-09-23 | 2011-08-10 | President and Fellows of Harvard College | Sirt4 and uses thereof |
EP2364359A2 (en) | 2008-09-26 | 2011-09-14 | Wyeth LLC | Compatible display vector systems |
ES2592216T3 (en) | 2008-09-26 | 2016-11-28 | Dana-Farber Cancer Institute, Inc. | Human anti-PD-1, PD-L1 and PD-L2 antibodies and their uses |
GB0817891D0 (en) | 2008-09-30 | 2008-11-05 | Medical Res Council | Antibodies against il-25 |
WO2010040073A1 (en) * | 2008-10-03 | 2010-04-08 | Xoma Technology Ltd. | Novel triple tag sequences and methods of use thereof |
US9192685B2 (en) * | 2008-10-07 | 2015-11-24 | Bracco Suisse S.A. | Targeting construct comprising anti-polymer antibody and contrast/therapeutic agents binding to the same |
SI2340038T1 (en) | 2008-10-10 | 2018-05-31 | Children's Medical Center Corporation | Biochemically stabilized hiv-1 env trimer vaccine |
CA2740440A1 (en) | 2008-10-14 | 2010-04-22 | Dyax Corp. | Use of igf-ii/igf-iie binding proteins for the treatment and prevention of systemic sclerosis-associated pulmonary fibrosis |
CA2932207A1 (en) | 2008-10-20 | 2010-12-09 | Abbvie Inc. | Isolation and purification of antibodies using protein a affinity chromatography |
EP2350270B1 (en) | 2008-10-24 | 2018-03-07 | The Government of the United States of America, as represented by the Secretary, Department of Health & Human Services | Human ebola virus species and compositions and methods thereof |
CA2739352C (en) | 2008-10-29 | 2021-07-13 | Wyeth Llc | Methods for purification of single domain antigen binding molecules |
DK3199553T3 (en) | 2008-10-29 | 2019-07-22 | Circular Commitment Company | METHODS AND AGENTS FOR DIAGNOSTICATION AND TREATMENT OF HEPATOCELLULAR CARCINOM |
KR101581986B1 (en) | 2008-10-29 | 2016-01-04 | 아블린쓰 엔.브이. | Formulations of single domain antigen binding molecules |
US9067981B1 (en) | 2008-10-30 | 2015-06-30 | Janssen Sciences Ireland Uc | Hybrid amyloid-beta antibodies |
KR101683033B1 (en) | 2008-10-31 | 2016-12-06 | 얀센 바이오테크 인코포레이티드 | Toll-like receptor 3 antagonists |
US9528160B2 (en) | 2008-11-07 | 2016-12-27 | Adaptive Biotechnolgies Corp. | Rare clonotypes and uses thereof |
US8628927B2 (en) | 2008-11-07 | 2014-01-14 | Sequenta, Inc. | Monitoring health and disease status using clonotype profiles |
EP2356251A1 (en) | 2008-11-07 | 2011-08-17 | Novartis Forschungsstiftung, Zweigniederlassung Friedrich Miescher Institute For Biomedical Research | Teneurin and cancer |
DK2356270T3 (en) | 2008-11-07 | 2016-12-12 | Fabrus Llc | Combinatorial antibody libraries and uses thereof |
US9506119B2 (en) | 2008-11-07 | 2016-11-29 | Adaptive Biotechnologies Corp. | Method of sequence determination using sequence tags |
US8298533B2 (en) | 2008-11-07 | 2012-10-30 | Medimmune Limited | Antibodies to IL-1R1 |
ES2523740T3 (en) | 2008-11-07 | 2014-12-01 | Galaxy Biotech, Llc | Monoclonal antibodies to the fibroblast growth factor 2 receptor |
US8748103B2 (en) | 2008-11-07 | 2014-06-10 | Sequenta, Inc. | Monitoring health and disease status using clonotype profiles |
GB2467704B (en) | 2008-11-07 | 2011-08-24 | Mlc Dx Inc | A method for determining a profile of recombined DNA sequences in T-cells and/or B-cells |
US9365901B2 (en) | 2008-11-07 | 2016-06-14 | Adaptive Biotechnologies Corp. | Monitoring immunoglobulin heavy chain evolution in B-cell acute lymphoblastic leukemia |
US20110293605A1 (en) | 2008-11-12 | 2011-12-01 | Hasige Sathish | Antibody formulation |
EP2189539B2 (en) | 2008-11-21 | 2018-06-13 | Chimera Biotec GmbH | Conjugate complexes for analyte detection |
WO2010062995A2 (en) | 2008-11-26 | 2010-06-03 | Five Prime Therapeutics, Inc. | Compositions and methods for regulating collagen and smooth muscle actin expression by serpine2 |
WO2010062960A2 (en) | 2008-11-26 | 2010-06-03 | Cedars-Sinai Medical Center | METHODS OF DETERMINING RESPONSIVENESS TO ANTI-TNFα THERAPY IN INFLAMMATORY BOWEL DISEASE |
DK2370593T3 (en) | 2008-11-28 | 2016-07-04 | Univ Emory | A method for determining the effect of PD-1 Antagonists |
GB0822011D0 (en) | 2008-12-02 | 2009-01-07 | Queen Mary & Westfield College | Treatment |
CA2745111A1 (en) | 2008-12-03 | 2010-06-10 | Research Development Foundation | Modulation of olfml-3 mediated angiogenesis |
BRPI0922807A2 (en) * | 2008-12-04 | 2015-12-22 | Abbott Lab | double variable domain imonuglobulins and their uses |
AU2009324037B2 (en) | 2008-12-05 | 2015-07-30 | Glaxo Group Limited | Methods for selecting protease resistant polypeptides |
AU2009325878B2 (en) | 2008-12-08 | 2014-01-16 | Compugen Ltd. | TMEM154 polypeptides and polynucleotides, and uses thereof as a drug target for producing drugs and biologics |
SI2376535T1 (en) | 2008-12-09 | 2017-07-31 | F. Hoffmann-La Roche Ag | Anti-pd-l1 antibodies and their use to enhance t-cell function |
EA201100943A1 (en) | 2008-12-16 | 2012-05-30 | Новартис Аг | YEAST DISPLAY SYSTEMS |
SI2786762T1 (en) | 2008-12-19 | 2019-07-31 | Macrogenics, Inc. | Covalent diabodies and uses thereof |
BRPI0923652A2 (en) | 2008-12-26 | 2016-10-18 | Forerunner Pharma Res Co Ltd | cancer diagnosis and treatment using anti-lgr7 antibody |
US20120003235A1 (en) | 2008-12-31 | 2012-01-05 | Biogen Idec Ma Inc. | Anti-lymphotoxin antibodies |
EP2379116B1 (en) | 2009-01-07 | 2015-08-26 | Philogen S.p.A. | Antigens associated with endometriosis |
US9181315B2 (en) | 2009-01-08 | 2015-11-10 | Dana-Farber Cancer Institute, Inc. | Compositions and methods for induced brown fat differentiation |
GB0900425D0 (en) | 2009-01-12 | 2009-02-11 | Ucb Pharma Sa | Biological products |
CA2749572A1 (en) | 2009-01-14 | 2010-07-22 | Iq Therapeutics Bv | Combination antibodies for the treatment and prevention of disease caused by bacillus anthracis and related bacteria and their toxins |
PT2387627E (en) | 2009-01-15 | 2016-06-03 | Adaptive Biotechnologies Corp | Adaptive immunity profiling and methods for generation of monoclonal antibodies |
BRPI1007345A2 (en) | 2009-01-20 | 2019-04-16 | H. ZADEH Homayoun | mediated antibody bone regeneration |
CA2750581A1 (en) | 2009-01-21 | 2010-07-29 | Oxford Biotherapeutics Ltd. | Pta089 protein |
WO2010085590A1 (en) | 2009-01-23 | 2010-07-29 | Biosynexus Incorporated | Opsonic and protective antibodies specific for lipoteichoic acid gram positive bacteria |
EP2389587B1 (en) | 2009-01-26 | 2013-12-25 | Electrophoretics Limited | Diagnostic and prognostic methods relating to alzheimer's disease |
US20110165063A1 (en) * | 2009-01-29 | 2011-07-07 | Abbott Laboratories | Il-1 binding proteins |
KR20110110349A (en) * | 2009-01-29 | 2011-10-06 | 아보트 러보러터리즈 | Il-1 binding proteins |
WO2010087702A1 (en) | 2009-01-30 | 2010-08-05 | Stichting Katholieke Universiteit | TET2 gene as a marker for diagnosing a myelodysuplastic syndrome (MDS) or an acute myeloid leukemia (AML) and determining the prognosis in a subject |
WO2010087927A2 (en) | 2009-02-02 | 2010-08-05 | Medimmune, Llc | Antibodies against and methods for producing vaccines for respiratory syncytial virus |
EP3360879A1 (en) | 2009-02-05 | 2018-08-15 | ImmunoGen, Inc. | Benzodiazepine derivatives as cytotoxic agents |
US20120165340A1 (en) | 2009-02-11 | 2012-06-28 | Ludwing Institute For Cancer Research Ltd. | Pten phosphorylation-driven resistance to cancer treatment and altered patient prognosis |
US9364477B2 (en) | 2009-02-12 | 2016-06-14 | Cell Signaling Technology, Inc. | Mutant ROS expression in human cancer |
EP2396035A4 (en) | 2009-02-12 | 2012-09-12 | Human Genome Sciences Inc | Use of b lymphocyte stimulator protein antagonists to promote transplantation tolerance |
LT2398498T (en) * | 2009-02-17 | 2019-01-10 | Ucb Biopharma Sprl | Antibody molecules having specificity for human ox40 |
US9671400B2 (en) | 2009-02-19 | 2017-06-06 | Dako Denmark A/S | Conjugate molecules |
CA2753263A1 (en) | 2009-02-24 | 2010-09-02 | Glaxo Group Limited | Multivalent and/or multispecific rankl-binding constructs |
CA2753332A1 (en) | 2009-02-24 | 2010-09-02 | Glaxo Group Limited | Antigen-binding constructs |
US8030026B2 (en) | 2009-02-24 | 2011-10-04 | Abbott Laboratories | Antibodies to troponin I and methods of use thereof |
CA2753287A1 (en) | 2009-02-24 | 2010-09-02 | Glaxo Group Limited | Antigen-binding constructs |
GB0903325D0 (en) | 2009-02-26 | 2009-04-08 | Univ Aberdeen | Antibody molecules |
EP2810652A3 (en) | 2009-03-05 | 2015-03-11 | AbbVie Inc. | IL-17 binding proteins |
WO2010102167A1 (en) | 2009-03-05 | 2010-09-10 | Becton, Dickinson And Company | Matrix metalloproteinase-7 (mmp-7) monoclonal antibodies and methods for their use in the detection of ovarian cancer |
BRPI1009232B1 (en) | 2009-03-05 | 2022-05-03 | E.R. Squibb & Sons, Llc. | Isolated monoclonal antibody or an antigen-binding portion thereof, or an antibody fragment, composition comprising them, nucleic acid molecule, hybridoma and methods for preparing an anti-cadm1 antibody |
WO2010100247A1 (en) | 2009-03-06 | 2010-09-10 | Novartis Forschungsstiftung, Zweigniederlassung, Friedrich Miescher Institute For Biomedical Research | Novel therapy for anxiety |
WO2010102177A1 (en) | 2009-03-06 | 2010-09-10 | Becton, Dickinson And Company | Glycodelin monoclonal antibodies and methods for their use in the detection of ovarian cancer |
KR101667227B1 (en) | 2009-03-10 | 2016-10-18 | 가부시키가이샤 진 테크노 사이언스 | Generation, expression and characterization of the humanized k33n monoclonal antibody |
GB0904214D0 (en) | 2009-03-11 | 2009-04-22 | Ucb Pharma Sa | Biological products |
GB0904321D0 (en) | 2009-03-12 | 2009-04-22 | Cambridge Entpr Ltd | Modulation of T-cell mediated immune responses |
US8455203B2 (en) | 2009-03-13 | 2013-06-04 | Allergan, Inc. | Immuno-based retargeted endopeptidase activity assays |
JP2010210772A (en) | 2009-03-13 | 2010-09-24 | Dainippon Screen Mfg Co Ltd | Method of manufacturing liquid crystal display device |
WO2010106542A2 (en) | 2009-03-19 | 2010-09-23 | Yissum Research Development Company Of The Hebrew University Of Jerusalem Ltd. | USE OF NKp46 FOR PREVENTING DIABETES |
WO2010108153A2 (en) | 2009-03-20 | 2010-09-23 | Amgen Inc. | Carrier immunoglobulins and uses thereof |
US8883153B2 (en) | 2009-03-27 | 2014-11-11 | The Research for The State University of New York | Methods for preventing and treating angioedema |
CA2787099A1 (en) | 2009-03-30 | 2010-10-14 | Anice C. Lowen | Influenza virus hemagglutinin polypeptides containing stem domains, vaccines and uses thereof |
AU2010236787A1 (en) | 2009-04-01 | 2011-11-10 | Genentech, Inc. | Anti-FcRH5 antibodies and immunoconjugates and methods of use |
AU2010231494B2 (en) | 2009-04-03 | 2016-01-07 | Decode Genetics Ehf | Genetic markers for risk management of atrial fibrillation and stroke |
GB0905972D0 (en) | 2009-04-06 | 2009-05-20 | Medical Res Council | Antibodies against IL-17BR |
ES2581488T3 (en) | 2009-04-08 | 2016-09-06 | Lipum Ab | New methods for the treatment of inflammatory diseases |
US8575316B2 (en) | 2009-04-09 | 2013-11-05 | Daiichi Sankyo Company, Limited | Anti-Siglec-15 antibody |
EP2417984B1 (en) | 2009-04-10 | 2016-03-30 | Kyowa Hakko Kirin Co., Ltd. | Method for treatment of blood tumor using anti-tim-3 antibody |
EP2241323A1 (en) | 2009-04-14 | 2010-10-20 | Novartis Forschungsstiftung, Zweigniederlassung Friedrich Miescher Institute For Biomedical Research | Tenascin-W and brain cancers |
US8722860B2 (en) | 2009-04-16 | 2014-05-13 | Abbvie Biotherapeutics Inc. | Anti-TNF-α antibodies and their uses |
US20120052064A1 (en) | 2009-04-17 | 2012-03-01 | Yuuki Ito | Anti-hgf antibody combinational cancer therapies |
SG10201401604VA (en) | 2009-04-20 | 2014-08-28 | Oxford Biotherapeutics Ltd | Antibodies Specific To Cadherin-17 |
US9062116B2 (en) | 2009-04-23 | 2015-06-23 | Infinity Pharmaceuticals, Inc. | Anti-fatty acid amide hydrolase-2 antibodies and uses thereof |
WO2010126066A1 (en) | 2009-04-27 | 2010-11-04 | 協和発酵キリン株式会社 | Anti-il-3rα antibody for use in treatment of blood tumor |
WO2010125566A2 (en) | 2009-04-27 | 2010-11-04 | Technion Research And Development Foundation Ltd. | Markers for cancer detection |
MX2011011338A (en) | 2009-04-27 | 2012-04-19 | Novartis Ag | Composition and methods of use for therapeutic antibodies specific for the il-12 receptore betal subunit. |
JP5766179B2 (en) | 2009-04-27 | 2015-08-19 | ノバルティス アーゲー | Compositions and methods for increasing muscle growth |
EP2424891B1 (en) | 2009-04-29 | 2014-06-11 | The Henry M. Jackson Foundation for the Advancement of Military Medicine, Inc. | Erg monoclonal antibodies |
MY180699A (en) | 2009-04-29 | 2020-12-07 | Janssen Biotech Inc | Toll-like receptor 3 antagonists |
JP5677411B2 (en) | 2009-04-29 | 2015-02-25 | アッヴィ バイオテクノロジー リミテッド | Automatic injection equipment |
US8455249B2 (en) | 2009-05-01 | 2013-06-04 | The University Of Tokyo | Highly effective anti-cadherin antibody for induction of antibody-dependent cellular cytotoxicity in vivo |
UY32608A (en) | 2009-05-04 | 2010-12-31 | Pangenetics 110 B V | ANTIBODIES AGAINST THE NERVOUS GROWTH FACTOR (NGF) WITH IMPROVED LIVE STABILITY |
PE20160652A1 (en) | 2009-05-05 | 2016-07-09 | Novimmune Sa | ANTIBODIES THAT JOIN IL-17F |
EP2270053A1 (en) | 2009-05-11 | 2011-01-05 | U3 Pharma GmbH | Humanized AXL antibodies |
CA2762837C (en) | 2009-05-20 | 2021-08-03 | Novimmune S.A. | Synthetic polypeptide libraries and methods for generating naturally diversified polypeptide variants |
AU2010254136B2 (en) | 2009-05-26 | 2016-09-29 | Mount Sinai School Of Medicine | Monoclonal antibodies against influenza virus generated by cyclical administration and uses thereof |
US8685896B2 (en) | 2009-05-29 | 2014-04-01 | Morphosys Ag | Collection and methods for its use |
EP2436397B1 (en) | 2009-05-29 | 2017-05-10 | Chugai Seiyaku Kabushiki Kaisha | Pharmaceutical composition containing antagonist of egf family ligand as component |
ES2726945T3 (en) | 2009-06-03 | 2019-10-10 | Immunogen Inc | Conjugation Methods |
EP2261242A1 (en) | 2009-06-10 | 2010-12-15 | Universite Catholique De Louvain | Aspartate-N-acetyltransferase enzyme, diagnostic method and therapeutic method |
MX346002B (en) | 2009-06-17 | 2017-03-01 | Abbvie Biotherapeutics Inc | Anti-vegf antibodies and their uses. |
WO2011005481A1 (en) | 2009-06-22 | 2011-01-13 | Medimmune, Llc | ENGINEERED Fc REGIONS FOR SITE-SPECIFIC CONJUGATION |
GB0910725D0 (en) | 2009-06-22 | 2009-08-05 | Heptares Therapeutics Ltd | Mutant proteins and methods for producing them |
US20100330571A1 (en) | 2009-06-25 | 2010-12-30 | Robins Harlan S | Method of measuring adaptive immunity |
US20120101262A1 (en) | 2009-06-25 | 2012-04-26 | Bristol-Myers Squibb Company | Protein purification by caprylic acid (octanoic acid) precipitation |
WO2011000543A1 (en) | 2009-06-30 | 2011-01-06 | Philochem Ag | Murine antibody display library |
EP2272979A1 (en) | 2009-06-30 | 2011-01-12 | Centre National de la Recherche Scientifique (CNRS) | Method for testing a subject thought to be predisposed to having cancer |
CA2766861A1 (en) | 2009-07-09 | 2011-01-13 | F. Hoffmann-La Roche Ag | In vivo tumor vasculature imaging |
NZ598009A (en) | 2009-07-10 | 2013-11-29 | Decode Genetics Ehf | Genetic markers associated with risk of diabetes mellitus |
US9217157B2 (en) | 2009-07-27 | 2015-12-22 | Icahn School Of Medicine At Mount Sinai | Recombinant influenza viruses and uses thereof |
US8828406B2 (en) | 2009-07-30 | 2014-09-09 | Icahn School Of Medicine At Mount Sinai | Influenza viruses and uses thereof |
SG10201404340TA (en) | 2009-07-31 | 2014-10-30 | Shin Maeda | Cancer metastasis inhibitor |
US9259476B2 (en) | 2009-07-31 | 2016-02-16 | Wayne State University | Monophosphorylated lipid A derivatives |
CN102596220A (en) | 2009-07-31 | 2012-07-18 | 韦恩州立大学 | Monophosphorylated lipid A derivatives |
US8568719B2 (en) | 2009-08-13 | 2013-10-29 | Crucell Holland B.V. | Antibodies against human respiratory syncytial virus (RSV) and methods of use |
AU2010285974A1 (en) | 2009-08-17 | 2012-03-22 | Forerunner Pharma Research Co., Ltd. | Pharmaceutical composition comprising anti-HB-EGF antibody as active ingredient |
WO2011021146A1 (en) | 2009-08-20 | 2011-02-24 | Pfizer Inc. | Osteopontin antibodies |
GB0914691D0 (en) | 2009-08-21 | 2009-09-30 | Lonza Biologics Plc | Immunoglobulin variants |
EP2292266A1 (en) | 2009-08-27 | 2011-03-09 | Novartis Forschungsstiftung, Zweigniederlassung | Treating cancer by modulating copine III |
EP3029070A1 (en) | 2009-08-29 | 2016-06-08 | AbbVie Inc. | Therapeutic dll4 binding proteins |
WO2011026122A2 (en) | 2009-08-31 | 2011-03-03 | Amplimmune, Inc. | B7-h4 fusion proteins and methods of use thereof |
KR20120060877A (en) | 2009-09-01 | 2012-06-12 | 아보트 러보러터리즈 | Dual variable domain immunoglobulins and uses thereof |
US20110059111A1 (en) | 2009-09-01 | 2011-03-10 | Los Angeles Biomedical Research Institute At Harbor-Ucla Medical Center | Mammalian receptors as targets for antibody and active vaccination therapy against mold infections |
WO2011029823A1 (en) | 2009-09-09 | 2011-03-17 | Novartis Ag | Monoclonal antibody reactive with cd63 when expressed at the surface of degranulated mast cells |
EP2475682B1 (en) | 2009-09-10 | 2018-01-31 | UCB Biopharma SPRL | Multivalent antibodies |
KR20140048229A (en) | 2009-09-14 | 2014-04-23 | 애브비 인코포레이티드 | Methods for treating psoriasis |
JP2013504602A (en) * | 2009-09-14 | 2013-02-07 | ダイアックス コーポレーション | Newly designed gene package library containing HCCR3 |
PL2477656T3 (en) | 2009-09-15 | 2017-09-29 | Csl Limited | Treatment of neurological conditions |
EP2478101A1 (en) | 2009-09-16 | 2012-07-25 | Stichting Het Nederlands Kanker Instituut | Fra-1 target genes as drug targets for treating cancer |
RU2015153109A (en) | 2009-09-16 | 2019-01-15 | Дженентек, Инк. | SUPERSPIRAL AND / OR BINDING PROTEIN COMPLEXES AND THEIR APPLICATIONS |
CA2774260C (en) | 2009-09-16 | 2018-10-09 | Immunomedics, Inc. | Class i anti-cea antibodies and uses thereof |
US20110189183A1 (en) | 2009-09-18 | 2011-08-04 | Robert Anthony Williamson | Antibodies against candida, collections thereof and methods of use |
EP2305717A1 (en) | 2009-09-21 | 2011-04-06 | Koninklijke Nederlandse Akademie van Wetenschappen | Inhibiting TNIK for treating colon cancer |
EP2480573A1 (en) | 2009-09-22 | 2012-08-01 | Novartis Forschungsstiftung, Zweigniederlassung Friedrich Miescher Institute For Biomedical Research | Treating cancer by modulating mex-3 |
WO2011037983A1 (en) | 2009-09-23 | 2011-03-31 | Medarex, Inc. | Cation exchange chromatography |
TW201118166A (en) | 2009-09-24 | 2011-06-01 | Chugai Pharmaceutical Co Ltd | HLA class I-recognizing antibodies |
US8926976B2 (en) | 2009-09-25 | 2015-01-06 | Xoma Technology Ltd. | Modulators |
US9598692B2 (en) | 2009-09-25 | 2017-03-21 | University Of Oslo | Multivalent phage display systems and methods |
US9885711B2 (en) | 2009-09-25 | 2018-02-06 | Xoma Technology Ltd. | Screening methods |
GB201005063D0 (en) | 2010-03-25 | 2010-05-12 | Ucb Pharma Sa | Biological products |
WO2011038290A2 (en) | 2009-09-25 | 2011-03-31 | The U. S. A., As Represented By The Secretary, Department Of Health And Human Services | Neutralizing antibodies to hiv-1 and their use |
US20110076232A1 (en) | 2009-09-29 | 2011-03-31 | Ludwig Institute For Cancer Research | Specific binding proteins and uses thereof |
WO2011041584A2 (en) | 2009-09-30 | 2011-04-07 | President And Fellows Of Harvard College | Methods for modulation of autophagy through the modulation of autophagy-enhancing gene products |
WO2011040973A2 (en) | 2009-10-02 | 2011-04-07 | Ludwig Institute For Cancer Research Ltd. | Tnf-immunoconjugates with fibroblast activation protein antibodies and methods and uses thereof |
CA2776037A1 (en) | 2009-10-02 | 2011-04-07 | Ludwig Institute For Cancer Research Ltd | Anti-fibroblast activation protein antibodies and methods and uses thereof |
AR078470A1 (en) | 2009-10-02 | 2011-11-09 | Sanofi Aventis | ANTIBODIES THAT SPECIFICALLY JOIN THE EPHA2 RECEIVER |
EP2486023A4 (en) | 2009-10-06 | 2014-05-07 | Immunogen Inc | Potent conjugates and hydrophilic linkers |
US9096877B2 (en) | 2009-10-07 | 2015-08-04 | Macrogenics, Inc. | Fc region-containing polypeptides that exhibit improved effector function due to alterations of the extent of fucosylation, and methods for their use |
EP2470569A1 (en) | 2009-10-13 | 2012-07-04 | Oxford Biotherapeutics Ltd. | Antibodies against epha10 |
WO2011045352A2 (en) | 2009-10-15 | 2011-04-21 | Novartis Forschungsstiftung | Spleen tyrosine kinase and brain cancers |
AU2010306677B2 (en) | 2009-10-15 | 2013-05-23 | Abbvie Inc. | Dual variable domain immunoglobulins and uses thereof |
RS60577B1 (en) | 2009-10-20 | 2020-08-31 | Abbvie Inc | Isolation and purification of anti-il-13 antibodies using protein a affinity chromatography |
EP2491390B1 (en) | 2009-10-20 | 2014-03-26 | Dako Denmark A/S | Immunochemical detection of single target entities |
US20110098862A1 (en) | 2009-10-27 | 2011-04-28 | ExxonMobil Research Engineering Company Law Department | Multi-stage processes and control thereof |
GB0922434D0 (en) | 2009-12-22 | 2010-02-03 | Ucb Pharma Sa | antibodies and fragments thereof |
US9234037B2 (en) | 2009-10-27 | 2016-01-12 | Ucb Biopharma Sprl | Method to generate antibodies to ion channels |
GB0922435D0 (en) | 2009-12-22 | 2010-02-03 | Ucb Pharma Sa | Method |
CN102781963B (en) | 2009-10-27 | 2018-02-16 | Ucb医药有限公司 | Functionalized modification NAv1.7 antibody |
UY32979A (en) | 2009-10-28 | 2011-02-28 | Abbott Lab | IMMUNOGLOBULINS WITH DUAL VARIABLE DOMAIN AND USES OF THE SAME |
TW201122101A (en) | 2009-10-28 | 2011-07-01 | Facet Biotech Corp | Anti-EGFR antibodies and their uses |
US20120213801A1 (en) | 2009-10-30 | 2012-08-23 | Ekaterina Gresko | Phosphorylated Twist1 and cancer |
KR101836217B1 (en) | 2009-10-30 | 2018-03-08 | 얀센 바이오테크 인코포레이티드 | Il-17a antagonists |
WO2011053707A1 (en) | 2009-10-31 | 2011-05-05 | Abbott Laboratories | Antibodies to receptor for advanced glycation end products (rage) and uses thereof |
WO2011054007A1 (en) | 2009-11-02 | 2011-05-05 | Oxford Biotherapeutics Ltd. | Ror1 as therapeutic and diagnostic target |
AU2010315101B2 (en) | 2009-11-04 | 2016-01-28 | Fabrus Llc | Methods for affinity maturation-based antibody optimization |
EP2496243A2 (en) | 2009-11-04 | 2012-09-12 | Erasmus University Medical Center Rotterdam | Novel compounds for modulating neovascularisation and methods of treatment using these compounds |
US20110165648A1 (en) | 2009-11-04 | 2011-07-07 | Menno Van Lookeren Campagne | Co-crystal structure of factor D and anti-factor D antibody |
EP2496944A2 (en) | 2009-11-05 | 2012-09-12 | Novartis AG | Biomarkers predictive of progression of fibrosis |
US9244063B2 (en) | 2009-11-11 | 2016-01-26 | Gentian As | Immunoassay for assessing related analytes of different origin |
EP2499159B1 (en) | 2009-11-13 | 2017-01-04 | Dana-Farber Cancer Institute, Inc. | Compositions, kits, and methods for the diagnosis, prognosis, monitoring, treatment and modulation of post-transplant lymphoproliferative disorders and hypoxia associated angiogenesis disorders using galectin-1 |
GB0920127D0 (en) | 2009-11-17 | 2009-12-30 | Ucb Pharma Sa | Antibodies |
DK2501822T3 (en) | 2009-11-17 | 2017-11-27 | Squibb & Sons Llc | PROCEDURES FOR IMPROVED PROTEIN PRODUCTION |
EP2325311A1 (en) | 2009-11-18 | 2011-05-25 | Pierre Fabre Medicament | Novel phage display vector |
GB0920324D0 (en) | 2009-11-19 | 2010-01-06 | Ucb Pharma Sa | Antibodies |
TW201129379A (en) | 2009-11-20 | 2011-09-01 | Amgen Inc | Anti-Orai1 antigen binding proteins and uses thereof |
US9428586B2 (en) | 2009-12-01 | 2016-08-30 | Compugen Ltd | Heparanase splice variant |
SG181563A1 (en) | 2009-12-08 | 2012-07-30 | Abbott Gmbh & Co Kg | Monoclonal antibodies against the rgm a protein for use in the treatment of retinal nerve fiber layer degeneration |
MX2012006443A (en) | 2009-12-09 | 2012-06-28 | Inst Nat Sante Rech Med | Monoclonal antibodies that bind b7h6 and uses thereof. |
EP2513148B1 (en) | 2009-12-16 | 2016-08-31 | AbbVie Biotherapeutics Inc. | Anti-her2 antibodies and their uses |
US8765432B2 (en) | 2009-12-18 | 2014-07-01 | Oligasis, Llc | Targeted drug phosphorylcholine polymer conjugates |
EA201270662A1 (en) | 2009-12-23 | 2013-01-30 | 4-Антибоди Аг | BINDING ELEMENTS FOR HUMAN CYTAMEGALOVIRUS |
WO2011084882A2 (en) | 2010-01-05 | 2011-07-14 | Contrafect Corporation | Methods and compositions for enhanced immunological therapy and targeting of gram-positive bacteria |
SI2521568T1 (en) | 2010-01-06 | 2019-01-31 | Dyax Corp. | Plasma kallikrein binding proteins |
GB201000467D0 (en) | 2010-01-12 | 2010-02-24 | Ucb Pharma Sa | Antibodies |
WO2011088163A1 (en) | 2010-01-14 | 2011-07-21 | President And Fellows Of Harvard College | Methods for modulating skeletal remodeling and patterning by modulating shn2 activity, shn3 activity, or shn2 and shn3 activity in combination |
TWI505838B (en) | 2010-01-20 | 2015-11-01 | Chugai Pharmaceutical Co Ltd | Stabilized antibody |
US10429384B2 (en) | 2010-01-22 | 2019-10-01 | Dana-Farber Cancer Institute, Inc. | Compositions, kits, and methods for identification, assessment, prevention, and therapy of metabolic disorders |
EP2530109A4 (en) | 2010-01-29 | 2013-08-28 | Toray Industries | Polylactic acid-based resin sheet |
US20120014956A1 (en) | 2010-02-02 | 2012-01-19 | Hartmut Kupper | Methods and compositions for predicting responsiveness to treatment with tnf-alpha inhibitor |
EP2354244A1 (en) | 2010-02-04 | 2011-08-10 | Stichting Top Institute Food and Nutrition | MBL2 as a marker of liver-specific insulin resistance |
EP2354245A1 (en) | 2010-02-04 | 2011-08-10 | Stichting Top Institute Food and Nutrition | MBL2 as a marker of hepatic PPAR- activity |
TWI518325B (en) | 2010-02-04 | 2016-01-21 | 自治醫科大學 | Identification, assessment, and therapy of cancers with innate or acquired resistance to alk inhibitors |
WO2011097511A1 (en) | 2010-02-05 | 2011-08-11 | The United States Of America, As Represented By The Secretary Department Of Health & Human Services | REGULATORY B CELLS (tBREGS) AND THEIR USE |
ES2656168T3 (en) | 2010-02-10 | 2018-02-23 | Fujifilm Ri Pharma Co., Ltd. | Anti-cadherin antibody labeled with a radioactive metal |
MX2012009318A (en) | 2010-02-10 | 2012-09-07 | Novartis Ag | Methods and compounds for muscle growth. |
KR20120117931A (en) | 2010-02-12 | 2012-10-24 | 온코메드 파마슈티칼스, 인크. | Methods for identifying and isolating cells expressing a polypeptide |
EP2536760A4 (en) | 2010-02-17 | 2013-10-16 | Univ Johns Hopkins | Novel phosphorylation of cardiac troponin i as a monitor for cardiac injury |
US9701723B2 (en) | 2010-02-18 | 2017-07-11 | Icahn School Of Medicine At Mount Sinai | Vaccines for use in the prophylaxis and treatment of influenza virus disease |
TW202348631A (en) | 2010-02-24 | 2023-12-16 | 美商免疫遺傳股份有限公司 | Folate receptor 1 antibodies and immunoconjugates and uses thereof |
EP2542582A4 (en) | 2010-03-02 | 2013-12-04 | Abbvie Inc | Therapeutic dll4 binding proteins |
EP2544688B1 (en) | 2010-03-02 | 2016-09-07 | President and Fellows of Harvard College | Methods and compositions for treatment of angelman syndrome |
US10435458B2 (en) | 2010-03-04 | 2019-10-08 | Chugai Seiyaku Kabushiki Kaisha | Antibody constant region variants with reduced Fcgammar binding |
EP2542578A1 (en) | 2010-03-05 | 2013-01-09 | Novartis Forschungsstiftung, Zweigniederlassung Friedrich Miescher Institute For Biomedical Research | Smoc1, tenascin-c and brain cancers |
CN102971012B (en) | 2010-03-12 | 2016-05-04 | 伊缪诺金公司 | CD37 binding molecule and immunoconjugates thereof |
WO2011116026A2 (en) | 2010-03-15 | 2011-09-22 | The Board Of Trustees Of The University Of Illinois | Inhibitors of beta integrin-g protein alpha subunit binding interactions |
US20110256135A1 (en) | 2010-03-17 | 2011-10-20 | Wolfgang Fraunhofer | Anti-nerve growth factor (ngf) antibody compositions |
US10706955B2 (en) | 2010-03-23 | 2020-07-07 | Iogenetics, Llc | Bioinformatic processes for determination of peptide binding |
ES2717883T3 (en) | 2010-03-25 | 2019-06-26 | Ucb Biopharma Sprl | DVD-LG molecules stabilized with disulfide |
GB201005064D0 (en) | 2010-03-25 | 2010-05-12 | Ucb Pharma Sa | Biological products |
US20150231215A1 (en) | 2012-06-22 | 2015-08-20 | Randolph J. Noelle | VISTA Antagonist and Methods of Use |
TW201138821A (en) | 2010-03-26 | 2011-11-16 | Roche Glycart Ag | Bispecific antibodies |
US10745467B2 (en) | 2010-03-26 | 2020-08-18 | The Trustees Of Dartmouth College | VISTA-Ig for treatment of autoimmune, allergic and inflammatory disorders |
US9631018B2 (en) | 2010-03-26 | 2017-04-25 | The Trustees Of Dartmouth College | Vista regulatory T cell mediator protein, vista binding agents and use thereof |
AU2011235220B2 (en) | 2010-03-30 | 2016-03-10 | Mount Sinai School Of Medicine | Influenza virus vaccines and uses thereof |
TWI667257B (en) | 2010-03-30 | 2019-08-01 | 中外製藥股份有限公司 | Antibodies with modified affinity to fcrn that promote antigen clearance |
SI2552961T1 (en) | 2010-03-30 | 2018-02-28 | Janssen Biotech, Inc. | Humanized il-25 antibodies |
BR112012026227A2 (en) | 2010-04-13 | 2020-08-04 | Celldex Therapeutics, Inc. | human or humanized monoclonal antibody, bispecific molecule, expression vector, transformed cell, composition, and, uses of an antibody |
CA2796339C (en) | 2010-04-15 | 2020-03-31 | Abbott Laboratories | Amyloid-beta binding proteins |
WO2011131611A1 (en) | 2010-04-19 | 2011-10-27 | Novartis Forschungsstiftung, Zweigniederlassung Friedrich Miescher Institute For Biomedical Research | Modulating xrn1 |
EP2380909A1 (en) | 2010-04-26 | 2011-10-26 | Max-Planck-Gesellschaft zur Förderung der Wissenschaften e.V. | PTK-7 protein involved in breast cancer |
NZ629829A (en) | 2010-04-30 | 2015-11-27 | Alexion Pharma Inc | Anti-c5a antibodies and methods for using the antibodies |
WO2011140151A1 (en) | 2010-05-04 | 2011-11-10 | Dyax Corp. | Antibodies against epidermal growth factor receptor (egfr) |
MX2012012441A (en) | 2010-05-04 | 2013-02-26 | Merrimack Pharmaceuticals Inc | Antibodies against epidermal growth factor receptor (egfr) and uses thereof. |
ES2949159T3 (en) | 2010-05-06 | 2023-09-26 | Novartis Ag | Compositions and methods of use for low-density lipoprotein-related protein 6 (LRP6) therapeutic antibodies |
IL208820A0 (en) | 2010-10-19 | 2011-01-31 | Rachel Teitelbaum | Biologic female contraceptives |
KR20130066631A (en) | 2010-05-06 | 2013-06-20 | 노파르티스 아게 | Compositions and methods of use for therapeutic low density lipoprotein - related protein 6 (lrp6) multivalent antibodies |
US20110293629A1 (en) | 2010-05-14 | 2011-12-01 | Bastid Jeremy | Methods of Treating and/or Preventing Cell Proliferation Disorders with IL-17 Antagonists |
SI2571532T1 (en) | 2010-05-14 | 2017-10-30 | Abbvie Inc. | Il-1 binding proteins |
EA027039B1 (en) | 2010-05-14 | 2017-06-30 | Эмджен Инк. | High concentration antibody formulations |
GB201008541D0 (en) | 2010-05-21 | 2010-07-07 | Univ Geneve | Diagnostic methods |
JP5904552B2 (en) | 2010-05-28 | 2016-04-13 | 国立研究開発法人国立がん研究センター | Pancreatic cancer treatment |
EP4115906A1 (en) | 2010-05-28 | 2023-01-11 | Chugai Seiyaku Kabushiki Kaisha | Antitumor t cell response enhancer |
JP2013534515A (en) | 2010-06-01 | 2013-09-05 | モナシュ ユニバーシティ | Antibody to unprocessed receptor tyrosine kinase c-MET |
US8747854B2 (en) | 2010-06-03 | 2014-06-10 | Abbvie Biotechnology Ltd. | Methods of treating moderate to severe hidradenitis suppurativa with anti-TNF-alpha antibodies |
WO2012047324A2 (en) | 2010-06-10 | 2012-04-12 | President And Fellows Of Harvard College | Systems and methods for amplification and phage display |
US20130089538A1 (en) | 2010-06-10 | 2013-04-11 | Novartis Forschungsstiftung, Zweigniederlassung Friedrich Miescher Institute forBiomedical Researh | Treating cancer by modulating mammalian sterile 20-like kinase 3 |
PT2580240T (en) | 2010-06-14 | 2019-03-29 | Lykera Biomed S A | S100a4 antibodies and therapeutic uses thereof |
AU2011268310A1 (en) | 2010-06-16 | 2013-01-10 | Abbvie Inc. | Comparison of protein samples |
NZ603581A (en) | 2010-06-19 | 2015-05-29 | Sloan Kettering Inst Cancer | Anti-gd2 antibodies |
CA2803391C (en) | 2010-06-22 | 2021-11-09 | Neogenix Oncology, Inc. | Npc1 antibodies that bind a muc5ac epitope |
AU2011268780A1 (en) | 2010-06-25 | 2013-02-07 | Aston University | Glycoproteins having lipid mobilizing properties and therapeutic uses thereof |
US20130315895A1 (en) | 2010-07-01 | 2013-11-28 | Takeda Pharmaceutical Company Limited | COMBINATION OF A cMET INHIBITOR AND AN ANTIBODY TO HGF AND/OR cMET |
WO2012004565A1 (en) | 2010-07-06 | 2012-01-12 | Robert White | Cancer biomarker brf1 |
JP2013533746A (en) | 2010-07-06 | 2013-08-29 | アベオ ファーマシューティカルズ, インコーポレイテッド | Anti-RON antibody |
KR102007045B1 (en) | 2010-07-07 | 2019-08-05 | 티유비아이티에이케이 | Recombinant antibody structures binding to and blocking the activity of vascular endothelial growth factor 2(vegfr-2/kdr) |
WO2012006500A2 (en) | 2010-07-08 | 2012-01-12 | Abbott Laboratories | Monoclonal antibodies against hepatitis c virus core protein |
EA027835B1 (en) | 2010-07-09 | 2017-09-29 | Круселл Холланд Б.В. | Anti-human respiratory syncytial virus (rsv) antibodies and methods of use thereof |
EA201390085A1 (en) | 2010-07-09 | 2013-06-28 | Экселиксис, Инк. | COMPOSITIONS OF KINAZ INHIBITORS FOR CANCER TREATMENT |
UY33492A (en) | 2010-07-09 | 2012-01-31 | Abbott Lab | IMMUNOGLOBULINS WITH DUAL VARIABLE DOMAIN AND USES OF THE SAME |
NZ605449A (en) | 2010-07-09 | 2015-03-27 | Genentech Inc | Anti-neuropilin antibodies and methods of use |
MX2013000301A (en) | 2010-07-09 | 2013-05-09 | Biogen Idec Hemophilia Inc | Chimeric clotting factors. |
DK2593475T3 (en) | 2010-07-14 | 2016-05-30 | Merck Sharp & Dohme | Anti-ADDL monoclonal antibody and uses thereof |
WO2012009705A1 (en) | 2010-07-15 | 2012-01-19 | Zyngenia, Inc. | Ang-2 binding complexes and uses thereof |
WO2012007880A2 (en) | 2010-07-16 | 2012-01-19 | Ablynx Nv | Modified single domain antigen binding molecules and uses thereof |
EP4219805A1 (en) | 2010-07-16 | 2023-08-02 | Adimab, LLC | Antibody libraries |
AU2011283646B2 (en) | 2010-07-30 | 2015-07-09 | Novartis Ag | Fibronectin cradle molecules and libraries thereof |
CA2807127C (en) | 2010-08-02 | 2019-02-12 | Leslie S. Johnson | Covalent diabodies and uses thereof |
WO2012018387A2 (en) | 2010-08-02 | 2012-02-09 | Population Diagnotics, Inc. | Compositions and methods for discovery of causative mutations in genetic disorders |
KR20130100118A (en) | 2010-08-03 | 2013-09-09 | 아비에 인코포레이티드 | Dual variable domain immunoglobulins and uses therof |
WO2012019024A2 (en) | 2010-08-04 | 2012-02-09 | Immunogen, Inc. | Her3-binding molecules and immunoconjugates thereof |
WO2012019061A2 (en) | 2010-08-05 | 2012-02-09 | Stem Centrx, Inc. | Novel effectors and methods of use |
US20120101108A1 (en) | 2010-08-06 | 2012-04-26 | Cell Signaling Technology, Inc. | Anaplastic Lymphoma Kinase In Kidney Cancer |
AU2011289426A1 (en) | 2010-08-10 | 2013-02-28 | Amgen Inc. | Dual function in vitro target binding assay for the detection of neutralizing antibodies against target antibodies |
EP2420250A1 (en) | 2010-08-13 | 2012-02-22 | Universitätsklinikum Münster | Anti-Syndecan-4 antibodies |
EP2603526A1 (en) | 2010-08-13 | 2013-06-19 | Medimmune Limited | Monomeric polypeptides comprising variant fc regions and methods of use |
EP3533803B1 (en) | 2010-08-14 | 2021-10-27 | AbbVie Inc. | Anti-amyloid-beta antibodies |
WO2012022734A2 (en) | 2010-08-16 | 2012-02-23 | Medimmune Limited | Anti-icam-1 antibodies and methods of use |
MA34472B1 (en) | 2010-08-17 | 2013-08-01 | Stichting Katholieke Univ | NEW DIAGNOSIS METHOD FOR FEVER Q USING CELLULAR IMMUNOLOGICAL TESTING |
HUE058226T2 (en) | 2010-08-19 | 2022-07-28 | Zoetis Belgium S A | Anti-ngf antibodies and their use |
CU24094B1 (en) | 2010-08-20 | 2015-04-29 | Novartis Ag | ANTIBODIES FOR THE RECEIVER 3 OF THE EPIDERMAL GROWTH FACTOR (HER3) |
GB201014033D0 (en) | 2010-08-20 | 2010-10-06 | Ucb Pharma Sa | Biological products |
CA2809433A1 (en) | 2010-08-26 | 2012-03-01 | Abbvie Inc. | Dual variable domain immunoglobulins and uses thereof |
SG10201506782XA (en) | 2010-08-27 | 2015-10-29 | Stem Centrx Inc | Notum protein modulators and methods of use |
ES2715177T3 (en) | 2010-09-01 | 2019-06-03 | Genzyme Corp | Treatment of myocardial infarction using tgf-beta antagonists |
WO2012028703A1 (en) | 2010-09-02 | 2012-03-08 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Method for the prognosis of the progression of cancer |
CN106620693A (en) | 2010-09-03 | 2017-05-10 | 艾伯维施特姆森特克斯有限责任公司 | Novel modulators and methods of use |
US20130171159A1 (en) | 2010-09-10 | 2013-07-04 | Brian Arthur Hemmings | Phosphorylated twist1 and metastasis |
EP2614085B1 (en) | 2010-09-10 | 2016-04-20 | Apexigen, Inc. | Anti-il-1 beta antibodies and methods of use |
PL2616090T3 (en) | 2010-09-17 | 2023-12-18 | Takeda Pharmaceutical Company Limited | Stabilization of immunoglobulins through aqueous formulation with histidine at weak acidic to neutral ph |
WO2012035518A1 (en) | 2010-09-17 | 2012-03-22 | Compugen Ltd. | Compositions and methods for treatment of drug resistant multiple myeloma |
US20120122076A1 (en) | 2010-09-20 | 2012-05-17 | Abbott Laboratories | Purification of antibodies using simulated moving bed chromatography |
CA2811678C (en) | 2010-09-21 | 2019-10-01 | Stichting Katholieke Universiteit | Novel method for diagnosing lyme disease using a cellular immunological test |
EP2619226B1 (en) | 2010-09-22 | 2018-09-12 | Amgen Inc. | Carrier immunoglobulins and uses thereof |
ES2719624T3 (en) | 2010-09-23 | 2019-07-11 | Prec Biologics Inc | Peptidomimetics of colon and pancreas cancer |
WO2012039756A2 (en) | 2010-09-24 | 2012-03-29 | Full Spectrum Genetics, Inc. | Method of analyzing binding interactions |
EP3050899B1 (en) | 2010-09-27 | 2019-09-04 | Janssen Biotech, Inc. | Antibodies binding human collagen ii |
PT2621526T (en) | 2010-09-29 | 2018-08-02 | Seattle Genetics Inc | Antibody drug conjugates (adc) that bind to 191p4d12 proteins |
US9005907B2 (en) | 2010-10-01 | 2015-04-14 | St. Jude Children's Research Hospital | Methods and compositions for typing molecular subgroups of medulloblastoma |
US8525237B1 (en) | 2010-10-04 | 2013-09-03 | The Regents Of The University Of California | Electrically conductive polymer nanowires with incorporated viruses |
CN103154037A (en) | 2010-10-05 | 2013-06-12 | 诺瓦提斯公司 | Anti-IL 12 Rbeta 1 antibodies and their use in treating autoimmune and inflammatory disorders |
GB201016864D0 (en) | 2010-10-06 | 2010-11-17 | Univ Aston | Therapeutic methods |
BR112013009083B1 (en) | 2010-10-13 | 2021-08-10 | Janssen Biotech, Inc. | HUMAN ANTIBODIES TO ONCOSTATIN M, ITS MANUFACTURING PROCESS, ANTIGEN-BINDING FRAGMENT, PHARMACEUTICAL COMPOSITION, ISOLATED POLYNUCLEOTIDE, RECOMBINANT HOST CELL STABLELY TRANSFORMED OR TRANSFECTED |
JP6000959B2 (en) | 2010-10-19 | 2016-10-05 | メイヨ・ファウンデーション・フォー・メディカル・エデュケーション・アンド・リサーチ | Human antibodies and their diagnostic and therapeutic uses for the treatment of neurological diseases |
WO2012052391A1 (en) | 2010-10-19 | 2012-04-26 | Glaxo Group Limited | Polypeptide with jmjd3 catalytic activity |
JP6121906B2 (en) | 2010-10-22 | 2017-04-26 | シアトル ジェネティクス,インコーポレーテッド | Synergistic effect between auristatin antibody drug conjugate and PI3K-AKTmTOR pathway inhibitor |
EP2632481A1 (en) | 2010-10-25 | 2013-09-04 | Regents Of The University Of Minnesota | Therapeutic composition for treatment of glioblastoma |
EP3326645B1 (en) | 2010-10-25 | 2020-03-18 | Biogen MA Inc. | Methods for determining differences in alpha-4 integrin activity by correlating differences in svcam and/or smadcam levels |
AU2011321374B2 (en) | 2010-10-29 | 2016-04-28 | Daiichi Sankyo Company,Limited | Novel anti-DR5 antibody |
EP3404043B1 (en) | 2010-10-29 | 2022-10-26 | Perseus Proteomics Inc. | Anti-cdh3 antibody having high internalization capacity |
US20130224116A1 (en) | 2010-11-05 | 2013-08-29 | TransBio Ltd. | Markers of Endothelial Progenitor Cells and Uses Thereof |
WO2012062318A1 (en) | 2010-11-08 | 2012-05-18 | Dako Denmark A/S | Quantification of single target molecules in histological samples |
US20140066431A1 (en) | 2010-11-15 | 2014-03-06 | Exelixis, Inc. | Benzoxazepines as Inhibitors of PI3K/mTOR and Methods of Their Use and Manufacture |
EP2640366A2 (en) | 2010-11-15 | 2013-09-25 | Exelixis, Inc. | Benzoxazepines as inhibitors of pi3k/mtor and methods of their use and manufacture |
WO2012065937A1 (en) | 2010-11-15 | 2012-05-24 | Novartis Forschungsstiftung, Zweigniederlassung, Friedrich Miescher Institute For Biomedical Research | Anti-fungal agents |
US20140199682A1 (en) | 2010-11-17 | 2014-07-17 | Sea Lane Biotechnologies, Llc | Influenza neutralizing agents |
US9072766B2 (en) | 2010-11-18 | 2015-07-07 | Beth Israel Deaconess Medical Center, Inc. | Methods of treating obesity by inhibiting nicotinamide N-methyl transferase (NNMT) |
CN103874707B (en) | 2010-11-19 | 2017-04-19 | 卫材R&D管理有限公司 | Neutralizing anti-CCL20 antibodies |
EP2640742B1 (en) | 2010-11-19 | 2018-08-15 | MorphoSys AG | A collection of antibody sequences its use |
US20140378436A9 (en) | 2010-11-24 | 2014-12-25 | Exelixis, Inc. | Benzoxazepines as Inhibitors of PI3K/mTOR and Methods of Their use and Manufacture |
EP2643353A1 (en) | 2010-11-24 | 2013-10-02 | Novartis AG | Multispecific molecules |
EP2643351A1 (en) | 2010-11-24 | 2013-10-02 | Glaxo Group Limited | Multispecific antigen binding proteins targeting hgf |
AU2011337704B2 (en) | 2010-11-30 | 2017-06-15 | Chugai Seiyaku Kabushiki Kaisha | Antigen-binding molecule capable of binding to plurality of antigen molecules repeatedly |
AR084053A1 (en) | 2010-11-30 | 2013-04-17 | Chugai Pharmaceutical Co Ltd | THERAPEUTIC AGENT THAT INDUCES CYTOTOXICITY |
SG190938A1 (en) | 2010-12-06 | 2013-07-31 | Seattle Genetics Inc | Humanized antibodies to liv-1 and use of same to treat cancer |
WO2012076010A1 (en) | 2010-12-06 | 2012-06-14 | Dako Denmark A/S | Combined histological stain |
EP2648748A1 (en) | 2010-12-08 | 2013-10-16 | Stem Centrx, Inc. | Novel modulators and methods of use |
EP2465928A1 (en) | 2010-12-16 | 2012-06-20 | Academisch Medisch Centrum bij de Universiteit van Amsterdam | Treatment of Th17-mediated diseases |
KR20140003467A (en) | 2010-12-20 | 2014-01-09 | 메디뮨 리미티드 | Anti-il-18 antibodies and their uses |
EP2655401B1 (en) | 2010-12-20 | 2016-03-09 | The Regents of the University of Michigan | Inhibitors of the epidermal growth factor receptor-heat shock protein 90 binding interaction |
US20120275996A1 (en) | 2010-12-21 | 2012-11-01 | Abbott Laboratories | IL-1 Binding Proteins |
KR20130133247A (en) | 2010-12-21 | 2013-12-06 | 애브비 인코포레이티드 | Il-1-alpha and -beta bispecific dual variable domain immunoglobulins and their use |
JP6147670B2 (en) | 2010-12-22 | 2017-06-14 | テバ・ファーマシューティカルズ・オーストラリア・ピーティワイ・リミテッド | Modified antibodies with improved half-life |
WO2012088381A2 (en) | 2010-12-22 | 2012-06-28 | President And Fellows Of Harvard College | Continuous directed evolution |
EP2659269B1 (en) | 2010-12-23 | 2016-10-26 | Roche Diagniostics GmbH | Detection of a posttranslationally modified polypeptide by a bi-valent binding agent |
CN103384681B (en) | 2010-12-23 | 2018-05-18 | 霍夫曼-拉罗奇有限公司 | Bonding agent |
SG191153A1 (en) | 2010-12-23 | 2013-07-31 | Hoffmann La Roche | Polypeptide-polynucleotide-complex and its use in targeted effector moiety delivery |
CN103384831B (en) | 2010-12-23 | 2016-02-10 | 霍夫曼-拉罗奇有限公司 | Polypeptide dimer is detected by bivalent binders |
US20140038842A1 (en) | 2010-12-28 | 2014-02-06 | Xoma Technology | Cell surface display using pdz domains |
US9598499B2 (en) | 2010-12-30 | 2017-03-21 | Institut National De La Santé Et De La Recherche Médicale (Inserm) | Antigen binding formats for use in therapeutic treatments or diagnostic assays |
GB201100282D0 (en) | 2011-01-07 | 2011-02-23 | Ucb Pharma Sa | Biological methods |
US10208349B2 (en) | 2011-01-07 | 2019-02-19 | Ucb Biopharma Sprl | Lipocalin 2 as a biomarker for IL-17 inhibitor therapy efficacy |
BR112013017951B1 (en) | 2011-01-14 | 2022-09-27 | UCB Biopharma SRL | NEUTRALIZATION ANTIBODY, ISOLATED DNA SEQUENCE, CLONING OR EXPRESSION VECTOR, PROCESS FOR PRODUCTION OF THE ANTIBODY, PHARMACEUTICAL COMPOSITION, USE OF ANTIBODY AND USE OF PHARMACEUTICAL COMPOSITION |
WO2012097313A2 (en) | 2011-01-14 | 2012-07-19 | The Regents Of The University Of California | Therapeutic antibodies against ror-1 protein and methods for use of same |
KR20140009311A (en) | 2011-01-18 | 2014-01-22 | 암젠 인크 | Nav1.7 knockout mice and uses thereof |
MX337208B (en) | 2011-01-24 | 2016-02-17 | Abbvie Biotechnology Ltd | Automatic injection devices having overmolded gripping surfaces. |
EP2668210B1 (en) | 2011-01-26 | 2020-06-17 | Celldex Therapeutics, Inc. | Anti-kit antibodies and uses thereof |
WO2012106615A1 (en) | 2011-02-03 | 2012-08-09 | Xoma Technology Ltd. | Methods and materials for enhancing functional protein expression in bacteria |
US9956236B2 (en) | 2011-02-07 | 2018-05-01 | Cornell University | Methods for increasing immune responses using agents that directly bind to and activate IRE-1 |
GB201102189D0 (en) | 2011-02-08 | 2011-03-23 | King S College London | Materials and methods relating to cardiovascular imaging |
PE20140303A1 (en) | 2011-02-10 | 2014-03-22 | Roche Glycart Ag | MUTANT INTERLEUQUIN-2 POLYPEPTIDES |
CA2824252A1 (en) | 2011-02-10 | 2012-08-16 | Roche Glycart Ag | Improved immunotherapy |
MX346635B (en) | 2011-02-15 | 2017-03-27 | Immunogen Inc | Cytotoxic benzodiazepine derivatives. |
WO2012110824A1 (en) | 2011-02-18 | 2012-08-23 | Astrazeneca Ab | Binding agents with specificity for a nucleic acid modification |
SA112330278B1 (en) | 2011-02-18 | 2015-10-09 | ستيم سينتركس، انك. | Novel modulators and methods of use |
MX352889B (en) | 2011-02-25 | 2017-12-13 | Chugai Pharmaceutical Co Ltd | Fcîriib-specific fc antibody. |
WO2012133782A1 (en) | 2011-03-30 | 2012-10-04 | 中外製薬株式会社 | Retention of antigen-binding molecules in blood plasma and method for modifying immunogenicity |
WO2012118903A2 (en) | 2011-03-01 | 2012-09-07 | Amgen Inc. | Bispecific binding agents |
CN103501859B (en) | 2011-03-02 | 2017-08-25 | 博格有限责任公司 | Probing analysis and its application based on cell |
JP6097702B2 (en) | 2011-03-03 | 2017-03-15 | アペクシジェン, インコーポレイテッド | Anti-IL-6 receptor antibody and method of use thereof |
US9383364B2 (en) | 2011-03-07 | 2016-07-05 | University Of Louisville Research Foundation, Inc. | Predictive marker of DNMT1 inhibitor therapeutic efficacy and methods of using the marker |
EP2683736B1 (en) | 2011-03-09 | 2018-01-17 | Cell Signaling Technology, Inc. | Methods and reagents for creating monoclonal antibodies |
CA2827759C (en) | 2011-03-10 | 2018-10-16 | Omeros Corporation | Generation of anti-fn14 monoclonal antibodies by ex-vivo accelerated antibody evolution |
WO2012125735A1 (en) | 2011-03-15 | 2012-09-20 | Abott Laboratories | An integrated approach to the isolation and purification of antibodies |
EP3235508B1 (en) | 2011-03-16 | 2020-12-30 | Sanofi | Compositions comprising a dual v region antibody-like protein |
TW201239355A (en) | 2011-03-23 | 2012-10-01 | Abbott Lab | Methods and systems for the analysis of protein samples |
CN103517920B (en) | 2011-03-25 | 2018-04-17 | 安进公司 | Anti- hardened proteins (SCLEROSTIN) antibody crystals and its preparation |
WO2012135517A2 (en) | 2011-03-29 | 2012-10-04 | Immunogen, Inc. | Preparation of maytansinoid antibody conjugates by a one-step process |
ME03353B (en) | 2011-03-29 | 2019-10-20 | Immunogen Inc | Preparation of maytansinoid antibody conjugates by a one-step process |
CN103547592A (en) | 2011-03-30 | 2014-01-29 | 埃博灵克斯股份有限公司 | Methods of treating immune disorders with single domain antibodies against TNF-alpha |
WO2012134813A1 (en) | 2011-03-31 | 2012-10-04 | St. Jude Children's Research Hospital | Methods and compositions for identifying minimal residual disease in acute lymphoblastic leukemia |
KR20140027211A (en) | 2011-04-04 | 2014-03-06 | 유니버시티 오브 아이오와 리써치 파운데이션 | Methods of improving vaccine immunogenicity |
US20140186340A1 (en) | 2011-04-08 | 2014-07-03 | Gilead Biologics, Inc. | Methods and Compositions for Normalization of Tumor Vasculature by Inhibition of LOXL2 |
US20120328567A1 (en) | 2011-04-08 | 2012-12-27 | Steven Bushnell | Biomarkers predictive of therapeutic responsiveness to ifnb and uses thereof |
US9150644B2 (en) | 2011-04-12 | 2015-10-06 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Human monoclonal antibodies that bind insulin-like growth factor (IGF) I and II |
WO2012140627A1 (en) | 2011-04-15 | 2012-10-18 | Compugen Ltd. | Polypeptides and polynucleotides, and uses thereof for treatment of immune related disorders and cancer |
US20140193420A1 (en) | 2011-04-18 | 2014-07-10 | Chugai Seiyaku Kabushiki Kaisha | Diagnosis and treatment of cancer using anti-itm2a antibody |
EP2699691B1 (en) | 2011-04-19 | 2017-10-18 | Dako Denmark A/S | New method for enzyme-mediated signal amplification |
LT2699264T (en) | 2011-04-20 | 2018-07-10 | Medimmune, Llc | Antibodies and other molecules that bind b7-h1 and pd-1 |
RS57279B1 (en) | 2011-04-25 | 2018-08-31 | Daiichi Sankyo Co Ltd | Anti-b7-h3 antibody |
EP2702077A2 (en) | 2011-04-27 | 2014-03-05 | AbbVie Inc. | Methods for controlling the galactosylation profile of recombinantly-expressed proteins |
EA201892619A1 (en) | 2011-04-29 | 2019-04-30 | Роше Гликарт Аг | IMMUNOCONJUGATES CONTAINING INTERLEUKIN-2 MUTANT POLYPETIPS |
EP3508500A1 (en) | 2011-04-29 | 2019-07-10 | Apexigen, Inc. | Anti-cd40 antibodies and methods of use |
US9598496B2 (en) | 2011-05-09 | 2017-03-21 | Perseus Proteomics Inc. | Antibody capable of specifically recognizing transferrin receptor |
CN103842383B (en) | 2011-05-16 | 2017-11-03 | 健能隆医药技术(上海)有限公司 | Polyspecific FAB fusion proteins and its application method |
GB201108272D0 (en) | 2011-05-17 | 2011-06-29 | Cambridge Entpr Ltd | Methods relating to HCMV infected cells |
KR102030531B1 (en) | 2011-05-21 | 2019-10-10 | 마크로제닉스, 인크. | Deimmunized serum-binding domains and their use for extending serum half-life |
EP2714738B1 (en) | 2011-05-24 | 2018-10-10 | Zyngenia, Inc. | Multivalent and monovalent multispecific complexes and their uses |
AR086543A1 (en) | 2011-05-25 | 2014-01-08 | Bg Medicine Inc | GALECTIN-3 INHIBITORS AND METHODS OF USE OF THE SAME, PHARMACEUTICAL COMPOSITION |
EP2714741B1 (en) | 2011-05-25 | 2019-10-30 | Innate Pharma, S.A. | Anti-kir antibodies for the treatment of inflammatory disorders |
EP2726510B1 (en) | 2011-05-27 | 2023-03-08 | F. Hoffmann-La Roche AG | Dual targeting |
WO2012163521A1 (en) | 2011-05-27 | 2012-12-06 | Dutalys | Removal of monomeric targets |
EP2714084B1 (en) | 2011-06-02 | 2019-05-22 | Dyax Corp. | Fc RECEPTOR BINDING PROTEINS |
US8691231B2 (en) | 2011-06-03 | 2014-04-08 | Merrimack Pharmaceuticals, Inc. | Methods of treatment of tumors expressing predominantly high affinity EGFR ligands or tumors expressing predominantly low affinity EGFR ligands with monoclonal and oligoclonal anti-EGFR antibodies |
SG10201902706VA (en) | 2011-06-03 | 2019-04-29 | Xoma Technology Ltd | Antibodies specific for tgf-beta |
WO2012168259A1 (en) | 2011-06-06 | 2012-12-13 | Novartis Forschungsstiftung, Zweigniederlassung | Protein tyrosine phosphatase, non-receptor type 11 (ptpn11) and triple-negative breast cancer |
US9561274B2 (en) | 2011-06-07 | 2017-02-07 | University Of Hawaii | Treatment and prevention of cancer with HMGB1 antagonists |
WO2012170740A2 (en) | 2011-06-07 | 2012-12-13 | University Of Hawaii | Biomarker of asbestos exposure and mesothelioma |
AU2012266363A1 (en) | 2011-06-10 | 2014-01-09 | Corimmun Gmbh | Binding compounds to human beta1-adrenoreceptor (beta1-AR) and their use in the measurement of auto-anti-beta1-AR antibodies |
HUE038509T2 (en) | 2011-06-10 | 2018-10-29 | Medimmune Ltd | Anti-pseudomonas psl binding molecules and uses thereof |
WO2012172495A1 (en) | 2011-06-14 | 2012-12-20 | Novartis Ag | Compositions and methods for antibodies targeting tem8 |
CA2838973A1 (en) | 2011-06-17 | 2012-12-20 | Adrian L. Harris | Methods of enhancing the response to radiation in tumor therapy using anti-dll4 antibodies |
AU2012271413B2 (en) | 2011-06-17 | 2017-07-13 | President And Fellows Of Harvard College | Frizzled 2 as a target for therapeutic antibodies in the treatment of cancer |
WO2012177837A2 (en) | 2011-06-21 | 2012-12-27 | Immunogen, Inc. | Novel maytansinoid derivatives with peptide linker and conjugates thereof |
SG10201805064SA (en) | 2011-06-23 | 2018-07-30 | Ablynx Nv | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
EP2974737A1 (en) | 2011-06-23 | 2016-01-20 | Ablynx N.V. | Techniques for predicting, detecting and reducing a specific protein interference in assays involving immunoglobulin single variable domains |
EP4350345A2 (en) | 2011-06-23 | 2024-04-10 | Ablynx N.V. | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobin single variable domains |
JP2014527036A (en) | 2011-06-27 | 2014-10-09 | ザ ジャクソン ラボラトリー | Methods and compositions for the treatment of cancer and autoimmune diseases |
PE20140756A1 (en) | 2011-06-28 | 2014-07-04 | Oxford Biotherapeutics Ltd | ANTIBODIES THAT JOIN BST1 |
ME02632B (en) | 2011-06-28 | 2017-06-20 | Oxford Biotherapeutics Ltd | Therapeutic and diagnostic target |
AU2012277376B2 (en) | 2011-06-30 | 2016-11-24 | Compugen Ltd. | Polypeptides and uses thereof for treatment of autoimmune disorders and infection |
BR112013032630B1 (en) | 2011-06-30 | 2022-06-14 | Chugai Seiyaku Kabushiki Kaisha | HETERODIMERIZED POLYPEPTIDE COMPRISING IGG FC REGION |
ES2692519T3 (en) | 2011-07-01 | 2018-12-04 | Novartis Ag | Method to treat metabolic disorders |
EP2734236A4 (en) | 2011-07-13 | 2015-04-15 | Abbvie Inc | Methods and compositions for treating asthma using anti-il-13 antibodies |
GB201112056D0 (en) | 2011-07-14 | 2011-08-31 | Univ Leuven Kath | Antibodies |
US9738707B2 (en) | 2011-07-15 | 2017-08-22 | Biogen Ma Inc. | Heterodimeric Fc regions, binding molecules comprising same, and methods relating thereto |
WO2013010955A1 (en) | 2011-07-15 | 2013-01-24 | Morphosys Ag | Antibodies that are cross-reactive for macrophage migration inhibitory factor (mif) and d-dopachrome tautomerase (d-dt) |
WO2013012747A1 (en) | 2011-07-15 | 2013-01-24 | Oncomed Pharmaceuticals, Inc. | Rspo binding agents and uses thereof |
EP2548891A1 (en) | 2011-07-18 | 2013-01-23 | Universiteit Maastricht | Human monoclonal antibody against the gamma subunit of the acetylcholine receptor for use in the treatment of rhabdomyosarcoma. |
JP6176849B2 (en) | 2011-07-19 | 2017-08-09 | 中外製薬株式会社 | A stable protein-containing preparation containing arginine amide or a similar compound |
WO2013015821A1 (en) | 2011-07-22 | 2013-01-31 | The Research Foundation Of State University Of New York | Antibodies to the b12-transcobalamin receptor |
US9120858B2 (en) | 2011-07-22 | 2015-09-01 | The Research Foundation Of State University Of New York | Antibodies to the B12-transcobalamin receptor |
CA2842099A1 (en) | 2011-07-27 | 2013-01-31 | Glaxo Group Limited | Antigen binding constructs |
PT2739311T (en) | 2011-08-04 | 2018-03-26 | Amgen Inc | Method for treating bone gap defects |
US8663637B2 (en) | 2011-08-05 | 2014-03-04 | Research Development Foundation | Methods and compositions for modulation of Olfml3 mediated angiogenesis |
JP5944994B2 (en) | 2011-08-12 | 2016-07-05 | オメロス コーポレーション | Anti-FZD10 monoclonal antibodies and methods for their use |
AU2012296613B2 (en) | 2011-08-15 | 2016-05-12 | Amplimmune, Inc. | Anti-B7-H4 antibodies and their uses |
RU2617970C2 (en) | 2011-08-23 | 2017-04-28 | Рош Гликарт Аг | ANTIBODIES WITHOUT Fc-FRAGMENT INCLUDING TWO FAB-FRAGMENT AND METHODS OF APPLICATION |
SI2748202T1 (en) | 2011-08-23 | 2018-10-30 | Roche Glycart Ag | Bispecific antigen binding molecules |
US20130078250A1 (en) | 2011-08-23 | 2013-03-28 | Oliver Ast | Bispecific t cell activating antigen binding molecules |
CN103748114B (en) | 2011-08-23 | 2017-07-21 | 罗切格利卡特公司 | T cell activation bispecific antigen binding molecules |
US9550835B2 (en) | 2011-08-23 | 2017-01-24 | Chugai Seiyaku Kabushiki Kaisha | Anti-DDR1 antibody having anti-tumor activity |
DK2748192T3 (en) | 2011-08-23 | 2019-02-25 | Found Medicine Inc | KIF5B-RET-FUSION MOLECULES AND APPLICATIONS THEREOF |
KR101870555B1 (en) | 2011-08-23 | 2018-06-22 | 로슈 글리카트 아게 | Bispecific antibodies specific for t-cell activating antigens and a tumor antigen and methods of use |
US20130058947A1 (en) | 2011-09-02 | 2013-03-07 | Stem Centrx, Inc | Novel Modulators and Methods of Use |
US20140234903A1 (en) | 2011-09-05 | 2014-08-21 | Eth Zurich | Biosynthetic gene cluster for the production of peptide/protein analogues |
WO2013035824A1 (en) | 2011-09-07 | 2013-03-14 | ファーマロジカルズ・リサーチ プライベート リミテッド | Cancer stem cell isolation |
AU2012306341B2 (en) | 2011-09-09 | 2017-08-31 | Cambridge Enterprise Limited | Anti-Siglec-15 antibodies and uses thereof |
US10385475B2 (en) | 2011-09-12 | 2019-08-20 | Adaptive Biotechnologies Corp. | Random array sequencing of low-complexity libraries |
NZ622260A (en) | 2011-09-12 | 2016-11-25 | Janssen Biotech Inc | Toll-like receptor 3 antagonists |
WO2013039996A1 (en) | 2011-09-13 | 2013-03-21 | Dana-Farber Cancer Institute, Inc. | Compositions and methods for brown fat induction and activity using fndc5 |
GB201116092D0 (en) | 2011-09-16 | 2011-11-02 | Bioceros B V | Antibodies and uses thereof |
EP2771349B1 (en) | 2011-09-16 | 2020-02-26 | Iogenetics, LLC. | Bioinformatic processes for determination of peptide binding |
MX2014003308A (en) | 2011-09-20 | 2015-03-09 | Sinai School Medicine | Influenza virus vaccines and uses thereof. |
EP2759551B1 (en) | 2011-09-21 | 2019-05-22 | Fujirebio Inc. | Antibodies binding to an affinity complex comprising 25oh vitamin d2 or d3 and an antibody thereto |
LT3485903T (en) | 2011-09-23 | 2023-02-27 | Mereo Biopharma 5, Inc. | Vegf/dll4 binding agents and uses thereof |
EP2760886B1 (en) | 2011-09-26 | 2019-10-02 | Philogen S.p.A. | Immunocytokine combination therapy |
KR102239138B1 (en) | 2011-09-30 | 2021-04-12 | 추가이 세이야쿠 가부시키가이샤 | Antigen-binding molecule inducing immune response to target antigen |
TW201817745A (en) | 2011-09-30 | 2018-05-16 | 日商中外製藥股份有限公司 | Therapeutic antigen-binding molecule with a FcRn-binding domain that promotes antigen clearance |
WO2013047752A1 (en) | 2011-09-30 | 2013-04-04 | 中外製薬株式会社 | Antigen-binding molecule for promoting loss of antigens |
AU2012313594C1 (en) | 2011-09-30 | 2018-05-10 | Chugai Seiyaku Kabushiki Kaisha | Ion concentration-dependent binding molecule library |
WO2013047748A1 (en) | 2011-09-30 | 2013-04-04 | 中外製薬株式会社 | Antigen-binding molecule promoting disappearance of antigens having plurality of biological activities |
JP6271251B2 (en) | 2011-10-05 | 2018-01-31 | 中外製薬株式会社 | An antigen-binding molecule that promotes elimination of an antigen containing a sugar chain receptor-binding domain from plasma |
WO2013052933A2 (en) | 2011-10-06 | 2013-04-11 | The Board Of Trustees Of The University Of Illinois | Myosin binding protein-c for use in methods relating to diastolic heart failure |
JP6239517B2 (en) | 2011-10-10 | 2017-11-29 | メディミューン リミテッド | Treatment of rheumatoid arthritis |
US10221454B2 (en) | 2011-10-10 | 2019-03-05 | The Hospital For Sick Children | Methods and compositions for screening and treating developmental disorders |
JP2014530816A (en) | 2011-10-14 | 2014-11-20 | ノバルティスアーゲー | Antibodies and methods for Wnt pathway related diseases |
CA2853088C (en) | 2011-10-21 | 2018-03-13 | Adaptive Biotechnologies Corporation | Quantification of adaptive immune cell genomes in a complex mixture of cells |
MX2014004977A (en) | 2011-10-24 | 2014-09-11 | Abbvie Inc | Immunobinders directed against sclerostin. |
JP2014534218A (en) | 2011-10-24 | 2014-12-18 | アッヴィ・インコーポレイテッド | Immunobinding agents targeting TNF |
EP3603671A3 (en) | 2011-10-28 | 2020-07-29 | Chugai Seiyaku Kabushiki Kaisha | Cancer stem cell-specific molecule |
CN109134658B (en) | 2011-10-31 | 2022-10-14 | 中外制药株式会社 | Antigen binding molecules that control association of heavy and light chains |
JP2014533247A (en) | 2011-11-01 | 2014-12-11 | バイオノミクス インコーポレイテッド | Antibodies and methods of treating cancer |
EP2773667A1 (en) | 2011-11-01 | 2014-09-10 | Bionomics, Inc. | Anti-gpr49 antibodies |
AU2012332590B2 (en) | 2011-11-01 | 2016-10-20 | Bionomics, Inc. | Anti-GPR49 antibodies |
ES2697674T3 (en) | 2011-11-01 | 2019-01-25 | Bionomics Inc | Procedures to block the growth of cancer stem cells |
TWI571473B (en) | 2011-11-02 | 2017-02-21 | 埃派斯進有限公司 | Anti-kdr antibodies and methods of use |
WO2013067268A1 (en) | 2011-11-03 | 2013-05-10 | Tripath Imaging, Inc. | Methods and compositions for preparing samples for immunostaining |
WO2013067451A2 (en) | 2011-11-04 | 2013-05-10 | Population Diagnostics Inc. | Methods and compositions for diagnosing, prognosing, and treating neurological conditions |
CA3161431A1 (en) | 2011-11-07 | 2013-05-16 | Medimmune Limited | Combination therapies using anti-pseudomonas psl and pcrv binding molecules |
EP2776838A1 (en) | 2011-11-08 | 2014-09-17 | Novartis Forschungsstiftung, Zweigniederlassung Friedrich Miescher Institute For Biomedical Research | Early diagnostic of neurodegenerative diseases |
EP2776022A1 (en) | 2011-11-08 | 2014-09-17 | Novartis Forschungsstiftung, Zweigniederlassung Friedrich Miescher Institute For Biomedical Research | New treatment for neurodegenerative diseases |
BR112014011115A2 (en) | 2011-11-08 | 2017-06-13 | Pfizer | Methods for treating inflammatory disorders using anti-csf antibodies |
WO2013071233A1 (en) | 2011-11-10 | 2013-05-16 | The United States Of America, As Represented By The Secretary, Department Of Health & Human Services | Methods for detecting infectious agents and a novel virus detected thereby |
PT2776466T (en) | 2011-11-11 | 2017-11-30 | Ucb Biopharma Sprl | Albumin binding antibodies and binding fragments thereof |
US20140328853A1 (en) | 2011-11-16 | 2014-11-06 | Adrenomed Ag | Anti-adrenomedullin (adm) antibody or anti-adm antibody fragment or anti-adm non-ig scaffold for prevention or reduction of organ dysfunction or organ failure in a patient having a chronic or acute disease or acute condition |
PL2780370T3 (en) | 2011-11-16 | 2020-01-31 | Adrenomed Ag | Anti-adrenomedullin (adm) antibody or anti-adm antibody fragment or anti-adm non-ig scaffold for use in therapy of an acute disease or acute condition of a patient for stabilizing the circulation |
BR122019027917B1 (en) | 2011-11-16 | 2023-05-09 | Adrenomed Ag | USE OF AN ANTI-ADRENOMEDULLIN ANTIBODY (ADM) GRAFTED ON HUMAN OR HUMANIZED CDR OR ANTI-ADM ANTIBODY FRAGMENT THEREOF |
ES2617211T3 (en) | 2011-11-16 | 2017-06-15 | Sphingotec Gmbh | Adrenomedulin assays and methods to determine mature adrenomedulin |
EP2594587B1 (en) | 2011-11-16 | 2014-05-21 | AdrenoMed AG | Anti-Adrenomedullin (ADM) antibody or anti-ADM antibody fragment or anti-ADM non-Ig protein scaffold for reducing the risk of mortality in a patient having a chronic or acute disease or acute condition |
PT2780371T (en) | 2011-11-16 | 2019-01-30 | Adrenomed Ag | Anti-adrenomedullin (adm) antibody or anti-adm antibody fragment or anti-adm non-ig scaffold for regulating the fluid balance in a patient having a chronic or acute disease |
US9220775B2 (en) | 2011-11-23 | 2015-12-29 | Medimmune Llc | Binding molecules specific for HER3 and uses thereof |
WO2013081143A1 (en) | 2011-11-30 | 2013-06-06 | 中外製薬株式会社 | Drug containing carrier into cell for forming immune complex |
EP2786156A2 (en) | 2011-11-30 | 2014-10-08 | AbbVie Deutschland GmbH & Co KG | Methods and compositions for determining responsiveness to treatment with a tnf-alpha inhibitor |
CN104159924B (en) | 2011-12-05 | 2018-03-16 | 诺华股份有限公司 | The antibody of EGF-R ELISA 3 (HER3) |
EP2788382A2 (en) | 2011-12-05 | 2014-10-15 | Novartis AG | Antibodies for epidermal growth factor receptor 3 (her3) directed to domain ii of her3 |
AU2012347460B2 (en) | 2011-12-09 | 2017-05-25 | Adaptive Biotechnologies Corporation | Diagnosis of lymphoid malignancies and minimal residual disease detection |
US9499865B2 (en) | 2011-12-13 | 2016-11-22 | Adaptive Biotechnologies Corp. | Detection and measurement of tissue-infiltrating lymphocytes |
US9518128B2 (en) | 2011-12-14 | 2016-12-13 | Janssen Pharmaceuticals, Inc. | Thrombin-binding antibody molecules |
GB201121513D0 (en) | 2011-12-14 | 2012-01-25 | Cambridge Entpr Ltd | Thrombin-binding antibody molecules and uses thereof |
US10118958B2 (en) | 2011-12-14 | 2018-11-06 | AbbVie Deutschland GmbH & Co. KG | Composition and method for the diagnosis and treatment of iron-related disorders |
CA2855570A1 (en) | 2011-12-14 | 2013-06-20 | AbbVie Deutschland GmbH & Co. KG | Composition and method for the diagnosis and treatment of iron-related disorders |
US20150017157A1 (en) | 2011-12-19 | 2015-01-15 | Xoma (Us) Llc | Methods for treating acne |
JP6306513B2 (en) | 2011-12-20 | 2018-04-04 | ヤンセン バイオテツク,インコーポレーテツド | Anti-PHF-tau antibody and use thereof |
PE20150159A1 (en) | 2011-12-21 | 2015-02-08 | Novartis Ag | COMPOSITIONS AND METHODS FOR ANTIBODIES ACTING ON THE P FACTOR |
JP2015502397A (en) | 2011-12-23 | 2015-01-22 | ファイザー・インク | Engineered antibody constant regions for site-specific conjugation, and methods and uses therefor |
TWI593705B (en) | 2011-12-28 | 2017-08-01 | Chugai Pharmaceutical Co Ltd | Humanized anti-epiregulin antibody and cancer therapeutic agent containing the antibody as an active ingredient |
EP2797953B1 (en) | 2011-12-28 | 2020-06-03 | Amgen Inc. | Method of treating alveolar bone loss through the use of anti-sclerostin antibodies |
TW201333035A (en) | 2011-12-30 | 2013-08-16 | Abbvie Inc | Dual specific binding proteins directed against IL-13 and/or IL-17 |
EP2800583A1 (en) | 2012-01-02 | 2014-11-12 | Novartis AG | Cdcp1 and breast cancer |
GB201200259D0 (en) | 2012-01-09 | 2012-02-22 | Ohlin Per M | Novel therapies |
KR102104686B1 (en) | 2012-01-10 | 2020-04-24 | 바이오젠 엠에이 인코포레이티드 | Enhancement of transport of therapeutic molecules across the blood brain barrier |
GB201201332D0 (en) | 2012-01-26 | 2012-03-14 | Imp Innovations Ltd | Method |
MY176695A (en) | 2012-01-27 | 2020-08-19 | Abbvie Inc | Composition and method for the diagnosis and treatment of diseases associated with neurite degeneration |
AU2013216320A1 (en) | 2012-02-01 | 2014-04-03 | Compugen Ltd. | C10RF32 antibodies, and uses thereof for treatment of cancer |
EP2855522A1 (en) | 2012-02-03 | 2015-04-08 | MedImmune Limited | Process for reducing antibody aggregate levels and antibodies produced thereby |
EP2809682B1 (en) | 2012-02-03 | 2020-04-08 | F.Hoffmann-La Roche Ag | Bispecific antibody molecules with antigen-transfected t-cells and their use in medicine |
SI2812443T1 (en) | 2012-02-06 | 2019-10-30 | Inhibrx Inc | Cd47 antibodies and methods of use thereof |
EP2812452B1 (en) | 2012-02-09 | 2020-05-27 | Population Bio, Inc. | Methods and compositions for screening and treating developmental disorders |
EP2813568A4 (en) | 2012-02-09 | 2016-04-06 | Chugai Pharmaceutical Co Ltd | Modified fc region of antibody |
US20150105274A1 (en) | 2012-02-10 | 2015-04-16 | Phylogica Limited | Methods for the Characterisation of Interaction Sites on Target Proteins |
KR20140127854A (en) | 2012-02-10 | 2014-11-04 | 제넨테크, 인크. | Single-chain antibodies and other heteromultimers |
WO2013119990A2 (en) | 2012-02-10 | 2013-08-15 | Seattle Genetics, Inc. | Detection and treatment of cd30+ cancers |
PT2814844T (en) | 2012-02-15 | 2017-09-18 | Novo Nordisk As | Antibodies that bind and block triggering receptor expressed on myeloid cells-1 (trem-1) |
SI2814842T1 (en) | 2012-02-15 | 2018-10-30 | Novo Nordisk A/S | Antibodies that bind peptidoglycan recognition protein 1 |
US9550830B2 (en) | 2012-02-15 | 2017-01-24 | Novo Nordisk A/S | Antibodies that bind and block triggering receptor expressed on myeloid cells-1 (TREM-1) |
GB201203071D0 (en) | 2012-02-22 | 2012-04-04 | Ucb Pharma Sa | Biological products |
GB201203051D0 (en) | 2012-02-22 | 2012-04-04 | Ucb Pharma Sa | Biological products |
CA2864702A1 (en) | 2012-02-22 | 2013-08-29 | Amgen Inc. | Autologous mammalian models derived from induced pluripotent stem cells and related methods |
DK2817338T3 (en) | 2012-02-24 | 2017-10-23 | Abbvie Stemcentrx Llc | DLL3 modulators and methods of use |
JP6138108B2 (en) | 2012-02-24 | 2017-05-31 | 中外製薬株式会社 | Antigen-binding molecule that promotes disappearance of antigen via FcγRIIB |
US10077478B2 (en) | 2012-03-05 | 2018-09-18 | Adaptive Biotechnologies Corp. | Determining paired immune receptor chains from frequency matched subunits |
BR122020002414B1 (en) | 2012-03-15 | 2022-03-03 | Janssen Biotech, Inc | USE OF HUMAN ANTI-CD27 ANTIBODIES |
AU2013232114B2 (en) | 2012-03-15 | 2018-10-18 | Omeros Corporation | Composition and method for diversification of target sequences |
EP2828291A1 (en) | 2012-03-21 | 2015-01-28 | Yissum Research Development Company of The Hebrew University of Jerusalem Ltd. | Peptides derived from the d1-domain of nkp46 |
CA2866185C (en) | 2012-03-23 | 2021-04-06 | The Government Of The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Pathogenic phlebovirus isolates and compositions and methods of use |
US9592289B2 (en) | 2012-03-26 | 2017-03-14 | Sanofi | Stable IgG4 based binding agent formulations |
DK2831587T3 (en) | 2012-03-27 | 2018-07-23 | Ventana Med Syst Inc | Signaling conjugates and methods of use |
RU2014139546A (en) | 2012-03-27 | 2016-05-20 | Дженентек, Инк. | METHODS FOR THE FORECASTING, DIAGNOSTICS AND TREATMENT OF IDIOPATHIC PULMONARY FIBROSIS |
WO2013144240A1 (en) | 2012-03-29 | 2013-10-03 | Friedrich Miescher Institute For Biomedical Research | Inhibition of interleukin- 8 and/or its receptor cxcrl in the treatment her2/her3 -overexpressing breast cancer |
EP2832856A4 (en) | 2012-03-29 | 2016-01-27 | Chugai Pharmaceutical Co Ltd | Anti-lamp5 antibody and utilization thereof |
KR20140138215A (en) | 2012-03-30 | 2014-12-03 | 다이이찌 산쿄 가부시키가이샤 | Novel anti-siglec15 antibody |
KR20200105524A (en) | 2012-04-02 | 2020-09-07 | 버그 엘엘씨 | Interrogatory cell-based assays and uses thereof |
KR20150003251A (en) | 2012-04-04 | 2015-01-08 | 가부시키가이샤 페르세우스 프로테오믹스 | Conjugate Of Anti-CDH3(P-Cadherin) Antibody And Drug |
WO2013151649A1 (en) | 2012-04-04 | 2013-10-10 | Sialix Inc | Glycan-interacting compounds |
US9714298B2 (en) | 2012-04-09 | 2017-07-25 | Daiichi Sankyo Company, Limited | Anti-FGFR2 antibodies and methods of use thereof for treating cancer |
IN2014MN02274A (en) | 2012-04-17 | 2015-08-07 | Mayo Foundation | |
DK2838998T3 (en) | 2012-04-18 | 2018-01-15 | Cell Signaling Technology Inc | EGFR AND ROS1 IN CANCER |
MX360109B (en) | 2012-04-20 | 2018-10-23 | Merus Nv | Methods and means for the production of ig-like molecules. |
WO2013158275A1 (en) | 2012-04-20 | 2013-10-24 | Abbvie Inc. | Cell culture methods to reduce acidic species |
US9150645B2 (en) | 2012-04-20 | 2015-10-06 | Abbvie, Inc. | Cell culture methods to reduce acidic species |
US9067990B2 (en) | 2013-03-14 | 2015-06-30 | Abbvie, Inc. | Protein purification using displacement chromatography |
US9181572B2 (en) | 2012-04-20 | 2015-11-10 | Abbvie, Inc. | Methods to modulate lysine variant distribution |
DK2841457T3 (en) | 2012-04-27 | 2019-07-22 | Daiichi Sankyo Co Ltd | Antibody against ROBO4 |
US9212227B2 (en) | 2012-04-30 | 2015-12-15 | Janssen Biotech, Inc. | ST2L antibody antagonists for the treatment of ST2L-mediated inflammatory pulmonary conditions |
WO2013166290A1 (en) | 2012-05-04 | 2013-11-07 | Abbvie Biotherapeutics Inc. | P21 biomarker assay |
SG11201407107VA (en) | 2012-05-08 | 2014-11-27 | Adaptive Biotechnologies Corp | Compositions and method for measuring and calibrating amplification bias in multiplexed pcr reactions |
WO2013173364A2 (en) | 2012-05-14 | 2013-11-21 | Biogen Idec Ma Inc. | Lingo-2 antagonists for treatment of conditions involving motor neurons |
JP6122948B2 (en) | 2012-05-15 | 2017-04-26 | モルフォテック, インコーポレイテッド | Methods for the treatment of gastric cancer |
US20130309223A1 (en) | 2012-05-18 | 2013-11-21 | Seattle Genetics, Inc. | CD33 Antibodies And Use Of Same To Treat Cancer |
WO2013177115A2 (en) | 2012-05-21 | 2013-11-28 | Abbvie Inc. | Novel purification of human, humanized, or chimeric antibodies using protein a affinity chromatography |
WO2013177386A1 (en) | 2012-05-24 | 2013-11-28 | Abbvie Biotherapeutics Inc. | Biomarkers for predicting response to tweak receptor (tweakr) agonist therapy |
CN104603149B (en) | 2012-05-24 | 2017-06-30 | 万机集团有限公司 | The composition related to prevention and treatment rabies infection and method |
WO2013176754A1 (en) | 2012-05-24 | 2013-11-28 | Abbvie Inc. | Novel purification of antibodies using hydrophobic interaction chromatography |
DK2857420T3 (en) | 2012-05-30 | 2020-11-23 | Chugai Pharmaceutical Co Ltd | TARGET TISSUE SPECIFIC ANTIGIN BINDING MOLECULE |
US20150353630A1 (en) | 2012-05-30 | 2015-12-10 | Chugai Seiyaku Kabushiki Kaisha | Antigen-binding molecule for eliminating aggregated antigens |
EP2859018B1 (en) | 2012-06-06 | 2021-09-22 | Zoetis Services LLC | Caninized anti-ngf antibodies and methods thereof |
CA2875980A1 (en) | 2012-06-06 | 2013-12-12 | Oncomed Pharmaceuticals, Inc. | Binding agents that modulate the hippo pathway and uses thereof |
US11142563B2 (en) | 2012-06-14 | 2021-10-12 | Chugai Seiyaku Kabushiki Kaisha | Antigen-binding molecule containing modified Fc region |
AU2013278075B2 (en) | 2012-06-22 | 2018-05-17 | Cytomx Therapeutics, Inc. | Anti-jagged 1/Jagged 2 cross-reactive antibodies, activatable anti-Jagged antibodies and methods of use thereof |
WO2014039983A1 (en) | 2012-09-07 | 2014-03-13 | The Trustees Of Dartmouth College | Vista modulators for diagnosis and treatment of cancer |
FI3421486T3 (en) | 2012-06-22 | 2023-12-15 | Dartmouth College | Novel vista-ig constructs and the use of vista-ig for treatment of autoimmune, allergic and inflammatory disorders |
US9890215B2 (en) | 2012-06-22 | 2018-02-13 | King's College London | Vista modulators for diagnosis and treatment of cancer |
RU2015100656A (en) | 2012-06-27 | 2016-08-20 | Ф. Хоффманн-Ля Рош Аг | METHOD FOR PRODUCING ANTIBODY FC-FRAGMENT CONNECTING, INCLUDING AT LEAST ONE CONNECTING GROUP, WHICH SPECIALLY RELATED TO THE TARGET, AND THEIR APPLICATION |
BR112014029888A2 (en) | 2012-06-27 | 2020-05-12 | Hoffmann La Roche | METHODS OF PRODUCTION OF AN ANTIBODY, DETERMINATION OF A COMBINATION OF BINDING SITES AND TREATMENT OF AN INDIVIDUAL WITH CANCER, PHARMACEUTICAL FORMULATION, ANTIBODY AND USE OF AN ANTIBODY |
WO2014001324A1 (en) | 2012-06-27 | 2014-01-03 | Hoffmann-La Roche Ag | Method for selection and production of tailor-made highly selective and multi-specific targeting entities containing at least two different binding entities and uses thereof |
WO2014001557A1 (en) | 2012-06-28 | 2014-01-03 | Ucb Pharma S.A. | A method for identifying compounds of therapeutic interest |
WO2014001482A1 (en) | 2012-06-29 | 2014-01-03 | Novartis Forschungsstiftung, Zweigniererlassung, Friedrich Miescher Institute For Biomedical Research | Treating diseases by modulating a specific isoform of mkl1 |
AR091649A1 (en) | 2012-07-02 | 2015-02-18 | Bristol Myers Squibb Co | OPTIMIZATION OF ANTIBODIES THAT FIX THE LYMPHOCYTE ACTIVATION GEN 3 (LAG-3) AND ITS USES |
EP2870242A1 (en) | 2012-07-05 | 2015-05-13 | Novartis Forschungsstiftung, Zweigniederlassung Friedrich Miescher Institute For Biomedical Research | New treatment for neurodegenerative diseases |
AU2013285488B2 (en) | 2012-07-05 | 2018-03-22 | Ucb Pharma S.A. | Treatment for bone diseases |
WO2014006115A1 (en) | 2012-07-06 | 2014-01-09 | Novartis Ag | Combination of a phosphoinositide 3-kinase inhibitor and an inhibitor of the il-8/cxcr interaction |
WO2014011955A2 (en) | 2012-07-12 | 2014-01-16 | Abbvie, Inc. | Il-1 binding proteins |
HUE061555T2 (en) | 2012-07-13 | 2023-07-28 | Univ Pennsylvania | Toxicity management for anti-tumor activity of cars |
GB201213652D0 (en) | 2012-08-01 | 2012-09-12 | Oxford Biotherapeutics Ltd | Therapeutic and diagnostic target |
WO2014022759A1 (en) | 2012-08-03 | 2014-02-06 | Dana-Farber Cancer Institute, Inc. | Agents that modulate immune cell activation and methods of use thereof |
SG10201800535XA (en) | 2012-08-07 | 2018-02-27 | Roche Glycart Ag | Composition comprising two antibodies engineered to have reduced and increased effector function |
BR112015002085A2 (en) | 2012-08-08 | 2017-12-19 | Roche Glycart Ag | protein, polynucleotide, vector, host cell, method for producing protein, pharmaceutical composition, protein use, method of treatment and invention |
JP2015525792A (en) | 2012-08-09 | 2015-09-07 | ロシュ グリクアート アクチェンゲゼルシャフト | ASGPR antibody and use thereof |
US20140044675A1 (en) | 2012-08-10 | 2014-02-13 | Roche Glycart Ag | Interleukin-2 fusion proteins and uses thereof |
US9645151B2 (en) | 2012-08-17 | 2017-05-09 | California Institute Of Technology | Targeting phosphofructokinase and its glycosylation form for cancer |
EP2887965A1 (en) | 2012-08-22 | 2015-07-01 | ImmunoGen, Inc. | Cytotoxic benzodiazepine derivatives |
SG10201701424QA (en) | 2012-08-23 | 2017-04-27 | Agensys Inc | Antibody drug conjugates (adc) that bind to 158p1d7 proteins |
CN104662044B (en) | 2012-08-24 | 2018-10-30 | 加利福尼亚大学董事会 | For treating ROR1 cancers and inhibiting the antibody and vaccine that shift |
EP3597747B1 (en) | 2012-08-24 | 2023-03-15 | Chugai Seiyaku Kabushiki Kaisha | Mouse fcgammarii-specific fc antibody |
SG10201709559PA (en) | 2012-08-24 | 2017-12-28 | Chugai Pharmaceutical Co Ltd | Fcγriib-specific fc region variant |
EP2966088B1 (en) | 2012-08-31 | 2019-10-16 | The Scripps Research Institute | Antibodies that modulate eukaryotic cells |
NZ726258A (en) | 2012-08-31 | 2019-07-26 | Immunogen Inc | Antibodies and uses thereof to detect folate receptor 1 |
US9512214B2 (en) | 2012-09-02 | 2016-12-06 | Abbvie, Inc. | Methods to control protein heterogeneity |
KR20150043523A (en) | 2012-09-02 | 2015-04-22 | 애브비 인코포레이티드 | Methods to control protein heterogeneity |
JOP20200308A1 (en) | 2012-09-07 | 2017-06-16 | Novartis Ag | IL-18 binding molecules |
WO2014039860A2 (en) | 2012-09-07 | 2014-03-13 | University Of Louisville Research Foundation, Inc. | Compositions and methods for modulating dnmt1 inhibitor activity |
US9976180B2 (en) | 2012-09-14 | 2018-05-22 | Population Bio, Inc. | Methods for detecting a genetic variation in subjects with parkinsonism |
CA2922005A1 (en) | 2012-09-27 | 2014-04-03 | Population Diagnostics, Inc. | Methods and compositions for screening and treating developmental disorders |
JP6117222B2 (en) | 2012-09-27 | 2017-04-19 | 中外製薬株式会社 | FGFR3 fusion gene and drug targeting the same |
WO2014055442A2 (en) | 2012-10-01 | 2014-04-10 | The Trustees Of The University Of Pennsylvania | Compositions and methods for targeting stromal cells for the treatment of cancer |
NO2760138T3 (en) | 2012-10-01 | 2018-08-04 | ||
AU2013327423B2 (en) | 2012-10-01 | 2017-06-22 | Adaptive Biotechnologies Corporation | Immunocompetence assessment by adaptive immune receptor diversity and clonality characterization |
AU2013325443B2 (en) * | 2012-10-03 | 2019-01-31 | Livtech, Inc. | Anti-hDlk-1 antibody having an anti-tumor activity in vivo |
US9695232B2 (en) | 2012-10-03 | 2017-07-04 | Philogen S.P.A. | Anti-ED-A immunoconjugates for inflammatory bowel disease |
NZ707091A (en) | 2012-10-04 | 2018-12-21 | Immunogen Inc | Use of a pvdf membrane to purify cell-binding agent cytotoxic agent conjugates |
WO2014056783A1 (en) | 2012-10-08 | 2014-04-17 | Roche Glycart Ag | Fc-free antibodies comprising two fab-fragments and methods of use |
UA118441C2 (en) | 2012-10-08 | 2019-01-25 | Протена Біосаєнсиз Лімітед | Antibodies recognizing alpha-synuclein |
CN104870014A (en) | 2012-10-09 | 2015-08-26 | 比奥根Ma公司 | Combination therapies and uses for treatment of demyelinating disorders |
NZ746440A (en) | 2012-10-11 | 2019-11-29 | Daiichi Sankyo Co Ltd | Glycinamide derivatives and production methods thereof |
EP2906241B1 (en) | 2012-10-12 | 2020-01-08 | The Brigham and Women's Hospital, Inc. | Enhancement of the immune response |
KR102308915B1 (en) | 2012-10-15 | 2021-10-06 | 메디뮨 리미티드 | Antibodies to amyloid beta |
CA2888743C (en) | 2012-10-17 | 2024-01-02 | University Of Maryland, Office Of Technology Commercialization | Device and methods of using device for detection of aminoacidopathies |
WO2014061277A1 (en) | 2012-10-19 | 2014-04-24 | 第一三共株式会社 | Antibody-drug conjugate produced by binding through linker having hydrophilic structure |
EP2912064B1 (en) | 2012-10-24 | 2019-04-24 | Research Development Foundation | Jam-c antibodies and methods for treatment of cancer |
CN104918957B (en) | 2012-10-30 | 2018-11-16 | 埃派斯进有限公司 | Anti-CD 40 antibodies and its application method |
CA2890263C (en) | 2012-11-01 | 2020-03-10 | Abbvie Inc. | Anti-vegf/dll4 dual variable domain immunoglobulins and uses thereof |
US10189906B2 (en) | 2012-11-01 | 2019-01-29 | Max-Delrück-Centrum Für Molekulare Medizin | Antibody that binds CD269 (BCMA) suitable for use in the treatment of plasma cell diseases such as multiple myeloma and autoimmune diseases |
CA2890207A1 (en) | 2012-11-05 | 2014-05-08 | Foundation Medicine, Inc. | Novel ntrk1 fusion molecules and uses thereof |
AU2013337354A1 (en) | 2012-11-05 | 2015-05-21 | Genzyme Corporation | Compositions and methods for treating proteinopathies |
LT2918603T (en) | 2012-11-08 | 2018-10-25 | University Of Miyazaki | Antibody capable of specifically recognizing transferrin receptor |
WO2014074942A1 (en) | 2012-11-08 | 2014-05-15 | Illumina, Inc. | Risk variants of alzheimer's disease |
SG10201608703SA (en) | 2012-11-08 | 2016-12-29 | Eleven Biotherapeutics Inc | Il-6 antagonists and uses thereof |
UY35148A (en) | 2012-11-21 | 2014-05-30 | Amgen Inc | HETERODIMERIC IMMUNOGLOBULINS |
KR20240005211A (en) | 2012-11-21 | 2024-01-11 | 얀센 바이오테크 인코포레이티드 | BISPECIFIC EGFR/c-Met ANTIBODIES |
US10131682B2 (en) | 2012-11-24 | 2018-11-20 | Hangzhou Dac Biotech Co., Ltd. | Hydrophilic linkers and their uses for conjugation of drugs to a cell binding molecules |
US20140154255A1 (en) | 2012-11-30 | 2014-06-05 | Abbvie Biotherapeutics Inc. | Anti-vegf antibodies and their uses |
WO2014084859A1 (en) | 2012-11-30 | 2014-06-05 | Novartis Ag | Molecules and methods for modulating tmem16a activities |
AU2013355414B2 (en) | 2012-12-05 | 2017-02-02 | Novartis Ag | Compositions and methods for antibodies targeting EPO |
ES2780398T3 (en) | 2012-12-10 | 2020-08-25 | Biogen Ma Inc | Anti-blood dendritic cell antigen 2 antibody and use thereof |
CN108641002A (en) | 2012-12-18 | 2018-10-12 | 西奈山伊坎医学院 | Influenza virus vaccine and application thereof |
WO2014099997A1 (en) | 2012-12-18 | 2014-06-26 | Novartis Ag | Compositions and methods that utilize a peptide tag that binds to hyaluronan |
GB201223276D0 (en) | 2012-12-21 | 2013-02-06 | Ucb Pharma Sa | Antibodies and methods of producing same |
US9550986B2 (en) | 2012-12-21 | 2017-01-24 | Abbvie Inc. | High-throughput antibody humanization |
JP6359031B2 (en) | 2012-12-21 | 2018-07-18 | メディミューン,エルエルシー | Anti-H7CR antibody |
AU2013202668B2 (en) | 2012-12-24 | 2014-12-18 | Adelaide Research & Innovation Pty Ltd | Inhibition of cancer growth and metastasis |
DK2940135T5 (en) | 2012-12-27 | 2021-09-20 | Chugai Pharmaceutical Co Ltd | Heterodimerized polypeptide |
NZ709828A (en) | 2012-12-28 | 2019-07-26 | Prec Biologics Inc | Humanized monoclonal antibodies and methods of use for the diagnosis and treatment of colon and pancreas cancer |
US10717965B2 (en) | 2013-01-10 | 2020-07-21 | Gloriana Therapeutics, Inc. | Mammalian cell culture-produced neublastin antibodies |
CA3150658A1 (en) | 2013-01-18 | 2014-07-24 | Foundation Medicine, Inc. | Methods of treating cholangiocarcinoma |
WO2014120916A1 (en) | 2013-02-01 | 2014-08-07 | Bristol-Myers Squibb Company | Pegylated domain antibodies monovalent for cd28 binding and methods of use |
KR102276974B1 (en) | 2013-02-06 | 2021-07-13 | 인히브릭스, 인크. | Non-platelet depleting and non-red blood cell depleting cd47 antibodies and methods of use thereof |
SI2953969T1 (en) | 2013-02-08 | 2020-01-31 | Novartis Ag | Anti-il-17a antibodies and their use in treating autoimmune and inflammatory disorders |
GB201302447D0 (en) | 2013-02-12 | 2013-03-27 | Oxford Biotherapeutics Ltd | Therapeutic and diagnostic target |
WO2014129895A1 (en) | 2013-02-19 | 2014-08-28 | Stichting Vu-Vumc | Means and method for increasing the sensitivity of cancers for radiotherapy |
MX2015010682A (en) | 2013-02-22 | 2016-05-31 | Stemcentrx Inc | Novel antibody conjugates and uses thereof. |
FR3004184B1 (en) | 2013-02-26 | 2016-03-18 | Agronomique Inst Nat Rech | ANTI-GLUTEN ANTIBODY DESAMIDE AND USES THEREOF. |
EP2961770A1 (en) | 2013-02-26 | 2016-01-06 | Roche Glycart AG | Bispecific t cell activating antigen binding molecules |
MY192312A (en) | 2013-02-26 | 2022-08-17 | Roche Glycart Ag | Bispecific t cell activating antigen binding molecules |
RU2015140915A (en) | 2013-02-26 | 2017-04-03 | Роше Гликарт Аг | BSPECIFIC ANTI-BINDING MOLECULES ACTIVATING T-CELLS |
CA2902068C (en) | 2013-02-28 | 2023-10-03 | Caprion Proteomics Inc. | Tuberculosis biomarkers and uses thereof |
JP6423804B2 (en) | 2013-02-28 | 2018-11-14 | イミュノジェン・インコーポレーテッド | Complex containing cell binding agent and cytotoxic agent |
JP6494533B2 (en) | 2013-02-28 | 2019-04-03 | イミュノジェン・インコーポレーテッド | Complexes comprising maytansinoids as cell binding agents and cytotoxic agents |
EP2830651A4 (en) | 2013-03-12 | 2015-09-02 | Abbvie Inc | Human antibodies that bind human tnf-alpha and methods of preparing the same |
WO2014142646A1 (en) | 2013-03-13 | 2014-09-18 | Stichting Katholieke Universiteit | Q-fever diagnostic |
AU2014248515B2 (en) | 2013-03-13 | 2019-03-07 | Prothena Biosciences Limited | Tau immunotherapy |
CA2906688A1 (en) | 2013-03-14 | 2014-09-25 | Parkash S. Gill | Cancer treatment using antibodies that bind cell surface grp78 |
WO2014159960A1 (en) | 2013-03-14 | 2014-10-02 | Icahn School Of Medicine At Mount Sinai | Antibodies against influenza virus hemagglutinin and uses thereof |
US9302005B2 (en) | 2013-03-14 | 2016-04-05 | Mayo Foundation For Medical Education And Research | Methods and materials for treating cancer |
WO2014151878A2 (en) | 2013-03-14 | 2014-09-25 | Abbvie Inc. | Methods for modulating protein glycosylation profiles of recombinant protein therapeutics using monosaccharides and oligosacharides |
EP2968526A4 (en) | 2013-03-14 | 2016-11-09 | Abbott Lab | Hcv antigen-antibody combination assay and methods and compositions for use therein |
SG11201504260UA (en) | 2013-03-14 | 2015-10-29 | Abbvie Inc | Low acidic species compositions and methods for producing and using the same |
US9017687B1 (en) | 2013-10-18 | 2015-04-28 | Abbvie, Inc. | Low acidic species compositions and methods for producing and using the same using displacement chromatography |
JP6739329B2 (en) | 2013-03-14 | 2020-08-12 | アボット・ラボラトリーズAbbott Laboratories | HCV core lipid binding domain monoclonal antibody |
WO2014159554A1 (en) | 2013-03-14 | 2014-10-02 | Abbvie Inc. | Low acidic species compositions and methods for producing the same using displacement chromatography |
EP2970479B1 (en) | 2013-03-14 | 2019-04-24 | Novartis AG | Antibodies against notch 3 |
WO2014159430A1 (en) | 2013-03-14 | 2014-10-02 | Apexigen, Inc. | Anti-rankl antibodies and methods of use |
WO2014142882A1 (en) | 2013-03-14 | 2014-09-18 | Abbvie Inc. | Protein purification using displacement chromatography |
CA2902789A1 (en) | 2013-03-14 | 2014-09-18 | The Governing Council Of The University Of Toronto | Scaffolded peptidic libraries and methods of making and screening the same |
WO2014159579A1 (en) | 2013-03-14 | 2014-10-02 | Abbvie Inc. | MUTATED ANTI-TNFα ANTIBODIES AND METHODS OF THEIR USE |
JP2016512241A (en) | 2013-03-14 | 2016-04-25 | アボット・ラボラトリーズAbbott Laboratories | HCVNS3 recombinant antigen for improved antibody detection and mutants thereof |
WO2014144280A2 (en) | 2013-03-15 | 2014-09-18 | Abbvie Inc. | DUAL SPECIFIC BINDING PROTEINS DIRECTED AGAINST IL-1β AND / OR IL-17 |
RU2015144033A (en) | 2013-03-15 | 2017-04-26 | Эббви Байотекнолоджи Лтд. | ANTIBODIES AGAINST CD25 AND THEIR APPLICATION |
WO2014144292A2 (en) | 2013-03-15 | 2014-09-18 | Sanofi Pasteur Biologics , Llc | Antibodies against clostridium difficile toxins and methods of using the same |
US9469686B2 (en) | 2013-03-15 | 2016-10-18 | Abbott Laboratories | Anti-GP73 monoclonal antibodies and methods of obtaining the same |
JP2016515524A (en) | 2013-03-15 | 2016-05-30 | アッヴィ バイオテクノロジー リミテッド | Anti-CD25 antibodies and their use |
JP6466904B2 (en) | 2013-03-15 | 2019-02-06 | ヤンセン バイオテツク,インコーポレーテツド | Interferon alpha and omega antibody antagonists |
SI2968588T1 (en) | 2013-03-15 | 2019-05-31 | AbbVie Deutschland GmbH & Co. KG | Anti-egfr antibody drug conjugate formulations |
EA201890895A1 (en) | 2013-03-15 | 2019-02-28 | Зинджения, Инк. | MULTIVALENT AND MONOVALENT MULTIS-SPECIFIC COMPLEXES AND THEIR APPLICATION |
KR102207859B1 (en) | 2013-03-15 | 2021-01-27 | 메모리얼 슬로안 케터링 캔서 센터 | High affinity anti-gd2 antibodies |
CA2903546A1 (en) | 2013-03-15 | 2014-09-25 | Biogen Ma Inc. | Treatment and prevention of acute kidney injury using anti-alpha v beta 5 antibodies |
CA2899089C (en) | 2013-03-15 | 2021-10-26 | Biogen Ma Inc. | Factor ix polypeptide formulations |
CN105143257B (en) | 2013-03-15 | 2020-10-27 | 艾伯维生物医疗股份有限公司 | FC variants |
JP2016519070A (en) | 2013-03-15 | 2016-06-30 | アッヴィ・インコーポレイテッド | Purification of antibody-drug conjugate (ADC) |
RS57840B1 (en) | 2013-03-18 | 2018-12-31 | Biocerox Prod Bv | Humanized anti-cd134 (ox40) antibodies and uses thereof |
CN105102985B (en) | 2013-03-20 | 2018-05-18 | 斯弗因高泰克有限公司 | For blood pressure to be instructed to decline the adrenomedulin of therapy |
CN112870368A (en) | 2013-03-27 | 2021-06-01 | 西达-赛奈医疗中心 | Reduction and reversal of fibrosis and inflammation by inhibition of TL1A function and related signaling pathways |
US11267868B2 (en) | 2013-04-02 | 2022-03-08 | Chugai Seiyaku Kabushiki Kaisha | Fc region variant |
UA118028C2 (en) | 2013-04-03 | 2018-11-12 | Рош Глікарт Аг | Bispecific antibodies specific for fap and dr5, antibodies specific for dr5 and methods of use |
EP2983711A4 (en) | 2013-04-08 | 2016-11-23 | Cytodyn Inc | Felinized antibodies and methods of treating retroviral infections in felines |
GB201307501D0 (en) | 2013-04-25 | 2013-06-12 | Univ Aberdeen | Anti-fungal antibody molecules and uses thereof |
CN105308460A (en) | 2013-05-02 | 2016-02-03 | 天主教大学基金会 | Personalised medicine |
SG10201913751RA (en) | 2013-05-06 | 2020-03-30 | Scholar Rock Inc | Compositions and methods for growth factor modulation |
CA2912526C (en) | 2013-05-16 | 2021-09-14 | Kyoto University | Method for determining prognosis of cancer |
GB201309178D0 (en) | 2013-05-21 | 2013-07-03 | Ucl Business Plc | Enzyme and uses thereof |
AU2014268298B2 (en) | 2013-05-24 | 2019-01-17 | Medlmmune, Llc | Anti-B7-H5 antibodies and their uses |
WO2014194030A2 (en) | 2013-05-31 | 2014-12-04 | Immunogen, Inc. | Conjugates comprising cell-binding agents and cytotoxic agents |
SG11201509982UA (en) | 2013-06-06 | 2016-04-28 | Igenica Biotherapeutics Inc | |
US20160122829A1 (en) | 2013-06-06 | 2016-05-05 | Dana-Farber Cancer Institute, Inc. | Compositions and Methods for Identification, Assessment, Prevention, and Treatment of Cancer Using PD-L1 Isoforms |
ES2753419T3 (en) | 2013-06-07 | 2020-04-08 | Univ Duke | Complement factor H inhibitors |
EP3009518B1 (en) | 2013-06-11 | 2020-08-12 | National Center of Neurology and Psychiatry | Method for predicting post-therapy prognosis of relapsing-remitting multiple sclerosis (rrms) patient, and method for determining applicability of novel therapy |
US20160151486A1 (en) | 2013-06-13 | 2016-06-02 | Fast Foward Pharmaceuticals B.V. | CD40 Signalling Inhibitor and a Further Compound, Wherein the Further Compound is a Bile Acid, a Bile Acid Derivative, an TGR5-Receptor Agonist, an FXR Agonist or a Combination Thereof, for the Treatment of Chronic Inflammation, and the Prevention of Gastrointestinal Cancer or Fibrosis |
AR096601A1 (en) | 2013-06-21 | 2016-01-20 | Novartis Ag | ANTIBODIES OF LEXINED OXIDATED LDL RECEIVER 1 AND METHODS OF USE |
CN105517571A (en) | 2013-06-24 | 2016-04-20 | 中外制药株式会社 | Therapeutic agent comprising humanized anti-epiregulin antibody as active ingredient for non-small-cell lung carcinoma excluding adenocarcinoma |
US9708657B2 (en) | 2013-07-01 | 2017-07-18 | Adaptive Biotechnologies Corp. | Method for generating clonotype profiles using sequence tags |
WO2015003114A1 (en) | 2013-07-05 | 2015-01-08 | University Of Washington Through Its Center For Commercialization | Soluble mic neutralizing monoclonal antibody for treating cancer |
US9850302B2 (en) | 2013-07-12 | 2017-12-26 | Prothena Biosciences Limited | Antibodies that recognize IAPP |
US9951131B2 (en) | 2013-07-12 | 2018-04-24 | Prothena Biosciences Limited | Antibodies that recognize IAPP |
US10208125B2 (en) | 2013-07-15 | 2019-02-19 | University of Pittsburgh—of the Commonwealth System of Higher Education | Anti-mucin 1 binding agents and uses thereof |
EP3022295A4 (en) | 2013-07-19 | 2017-03-01 | Cedars-Sinai Medical Center | Signature of tl1a (tnfsf15) signaling pathway |
US20160175401A1 (en) | 2013-07-31 | 2016-06-23 | Dana-Farber Cancer Institute Inc. | Compoitions and methods for modulating thermogenesis using pth-related and egf-related compounds |
JP6510518B2 (en) | 2013-08-01 | 2019-05-08 | アジェンシス,インコーポレイテッド | Antibody-drug conjugate (ADC) that binds to the CD37 protein |
US9770461B2 (en) | 2013-08-02 | 2017-09-26 | California Institute Of Technology | Tailored glycopolymers as anticoagulant heparin mimetics |
US10227370B2 (en) | 2013-08-02 | 2019-03-12 | California Institute Of Technology | Heparan sulfate/heparin mimetics with anti-chemokine and anti-inflammatory activity |
RU2675516C2 (en) | 2013-08-02 | 2018-12-19 | Пфайзер Инк. | Anti-cxcr4 antibodies and antibody-drug conjugates |
CN104341504B (en) | 2013-08-06 | 2017-10-24 | 百奥泰生物科技(广州)有限公司 | Bispecific antibody |
US20160178610A1 (en) | 2013-08-07 | 2016-06-23 | Friedrich Miescher Institute For Biomedical Research | New screening method for the treatment Friedreich's ataxia |
US10077304B2 (en) | 2013-08-14 | 2018-09-18 | The Governing Council Of The University Of Toronto | Antibodies against frizzled receptor |
CN105960414A (en) | 2013-08-14 | 2016-09-21 | 诺华股份有限公司 | Methods of treating sporadic inclusion body myositis |
EP3036320B2 (en) | 2013-08-19 | 2024-04-03 | Biogen MA Inc. | Control of protein glycosylation by culture medium supplementation and cell culture process parameters |
CN106659909B (en) | 2013-08-21 | 2022-01-11 | 德克萨斯州大学系统董事会 | Compositions and methods for targeting connexin hemichannels |
RU2699289C2 (en) | 2013-08-26 | 2019-09-04 | Байонтек Рисерч Энд Дивелопмент, Инк. | Nucleic acids encoding human antibodies to sialyl-lewisa |
EP3892294A1 (en) | 2013-08-28 | 2021-10-13 | AbbVie Stemcentrx LLC | Site-specific antibody conjugation methods and compositions |
EP3338793A1 (en) | 2013-08-28 | 2018-06-27 | AbbVie Stemcentrx LLC | Novel sez6 modulators and methods of use |
KR102585409B1 (en) | 2013-08-30 | 2023-10-05 | 이뮤노젠 아이엔씨 | Antibodies and assays for detection of folate receptor 1 |
WO2015035044A2 (en) | 2013-09-04 | 2015-03-12 | Abbvie Biotherapeutics Inc. | Fc VARIANTS WITH IMPROVED ANTIBODY-DEPENDENT CELL-MEDIATED CYTOTOXICITY |
US10030071B2 (en) | 2013-09-05 | 2018-07-24 | University Of Miyazaki | Antibody which specifically reacts with human integrin A6B4 |
EP3760639A1 (en) | 2013-09-08 | 2021-01-06 | Kodiak Sciences Inc. | Zwitterionic polymer conjugates |
JP6445440B2 (en) | 2013-09-20 | 2018-12-26 | 中外製薬株式会社 | Treatment of bleeding disorders with anti-protein C antibodies |
EP3048899B1 (en) | 2013-09-25 | 2021-09-08 | Bioverativ Therapeutics Inc. | On-column viral inactivation methods |
DK3049521T3 (en) | 2013-09-25 | 2019-04-23 | Univ Cornell | Compounds for inducing antitumor immunity and methods thereof |
EP3049442A4 (en) | 2013-09-26 | 2017-06-28 | Costim Pharmaceuticals Inc. | Methods for treating hematologic cancers |
BR112016006197B1 (en) | 2013-09-27 | 2023-04-11 | Chugai Seiyaku Kabushiki Kaisha | METHOD FOR PRODUCING A BISPECIFIC POLYPEPTIDE ANTIBODY |
BR112016006502A2 (en) * | 2013-09-30 | 2017-09-19 | Chugai Pharmaceutical Co Ltd | METHOD FOR THE PRODUCTION OF ANTIGEN-BINDING MOLECULE USING MODIFIED HELPER PHAGUE |
CA2925897A1 (en) | 2013-09-30 | 2015-04-02 | Daiichi Sankyo Company, Limited | Anti-lps o11 antibody |
US10259875B2 (en) | 2013-10-01 | 2019-04-16 | Mayo Foundation For Medical Education And Research | Methods for treating cancer in patients with elevated levels of BIM |
WO2015050959A1 (en) | 2013-10-01 | 2015-04-09 | Yale University | Anti-kit antibodies and methods of use thereof |
KR102501920B1 (en) | 2013-10-02 | 2023-02-20 | 메디뮨 엘엘씨 | Neutralizing anti-influenza a antibodies and uses thereof |
US9598667B2 (en) | 2013-10-04 | 2017-03-21 | Abbvie Inc. | Use of metal ions for modulation of protein glycosylation profiles of recombinant proteins |
KR20160066024A (en) | 2013-10-08 | 2016-06-09 | 다이이찌 산쿄 가부시키가이샤 | Combination of anti-fgfr2 antibody and other agent |
NZ718766A (en) | 2013-10-08 | 2020-02-28 | Immunogen Inc | Anti-folr1 immunoconjugate dosing regimens |
US9181337B2 (en) | 2013-10-18 | 2015-11-10 | Abbvie, Inc. | Modulated lysine variant species compositions and methods for producing and using the same |
WO2015057939A1 (en) | 2013-10-18 | 2015-04-23 | Biogen Idec Ma Inc. | Anti-s1p4 antibodies and uses thereof |
US9085618B2 (en) | 2013-10-18 | 2015-07-21 | Abbvie, Inc. | Low acidic species compositions and methods for producing and using the same |
US8946395B1 (en) | 2013-10-18 | 2015-02-03 | Abbvie Inc. | Purification of proteins using hydrophobic interaction chromatography |
EP3733868A3 (en) | 2013-10-28 | 2021-01-13 | DOTS Technology Corp. | Allergen detection |
WO2015066190A1 (en) | 2013-10-29 | 2015-05-07 | President And Fellows Of Harvard College | Methods and compositions for inhibting oxidative stress |
GB201319374D0 (en) | 2013-11-01 | 2013-12-18 | Univ Nottingham | Glycans as functional cancer targets abd antibodies thereto |
US9840555B2 (en) | 2013-11-04 | 2017-12-12 | Li-Te Chin | Method for producing human monoclonal antibodies that binds to at least one part of HMGB1 |
BR112016010071A2 (en) | 2013-11-06 | 2017-12-05 | Janssen Biotech Inc | anti-ccl17 antibodies |
WO2015070068A1 (en) | 2013-11-07 | 2015-05-14 | Abbvie Inc. | Isolation and purification of antibodies |
TWI652279B (en) | 2013-11-11 | 2019-03-01 | 中外製藥股份有限公司 | Antigen-binding molecules containing altered antibody variable regions |
DK2891722T3 (en) | 2013-11-12 | 2019-01-07 | Population Bio Inc | METHODS AND COMPOSITIONS FOR DIAGNOSTICING, PROGRAMMING AND TREATMENT OF ENDOMETRIOSIS |
GB201320061D0 (en) | 2013-11-13 | 2013-12-25 | Electrophoretics Ltd | Materials nad methods for diagnosis and prognosis of liver cancer |
WO2015073884A2 (en) | 2013-11-15 | 2015-05-21 | Abbvie, Inc. | Glycoengineered binding protein compositions |
AU2014349828B2 (en) | 2013-11-15 | 2021-01-28 | Centre National De La Recherche Scientifique | A molecular marker of Plasmodium falciparum artemisinin resistance |
US9309314B2 (en) | 2013-12-03 | 2016-04-12 | Agency For Science, Technology And Research (A*Star) | Polypeptides, nucleic acids and uses thereof |
SG11201604495PA (en) | 2013-12-04 | 2016-07-28 | Chugai Pharmaceutical Co Ltd | Antigen-binding molecules, the antigen-binding activity of which varies according to the concentration of compounds, and libraries of said molecules |
WO2015082724A1 (en) | 2013-12-08 | 2015-06-11 | Peptcell Limited | Hiv antigens and antibodies and compositions, methods and uses thereof |
US9914769B2 (en) | 2014-07-15 | 2018-03-13 | Kymab Limited | Precision medicine for cholesterol treatment |
US8980273B1 (en) | 2014-07-15 | 2015-03-17 | Kymab Limited | Method of treating atopic dermatitis or asthma using antibody to IL4RA |
US9045545B1 (en) | 2014-07-15 | 2015-06-02 | Kymab Limited | Precision medicine by targeting PD-L1 variants for treatment of cancer |
US8992927B1 (en) | 2014-07-15 | 2015-03-31 | Kymab Limited | Targeting human NAV1.7 variants for treatment of pain |
US8986691B1 (en) | 2014-07-15 | 2015-03-24 | Kymab Limited | Method of treating atopic dermatitis or asthma using antibody to IL4RA |
US8986694B1 (en) | 2014-07-15 | 2015-03-24 | Kymab Limited | Targeting human nav1.7 variants for treatment of pain |
US9067998B1 (en) | 2014-07-15 | 2015-06-30 | Kymab Limited | Targeting PD-1 variants for treatment of cancer |
CA3225453A1 (en) | 2013-12-19 | 2015-06-25 | Novartis Ag | Human mesothelin chimeric antigen receptors and uses thereof |
CN104721225A (en) | 2013-12-19 | 2015-06-24 | 高露洁-棕榄公司 | Oral care composition |
JP2017500017A (en) | 2013-12-20 | 2017-01-05 | バイオジェン・エムエイ・インコーポレイテッドBiogen MA Inc. | Use of perfusion seed cultures to improve biopharmaceutical fed-batch production capacity and product quality |
US11708411B2 (en) | 2013-12-20 | 2023-07-25 | Wake Forest University Health Sciences | Methods and compositions for increasing protective antibody levels induced by pneumococcal polysaccharide vaccines |
EP2960252A1 (en) | 2014-06-26 | 2015-12-30 | Institut Pasteur | Phospholipase for treatment of immunosuppression |
PL3712174T3 (en) | 2013-12-24 | 2022-07-04 | Janssen Pharmaceutica Nv | Anti-vista antibodies and fragments |
US11014987B2 (en) | 2013-12-24 | 2021-05-25 | Janssen Pharmaceutics Nv | Anti-vista antibodies and fragments, uses thereof, and methods of identifying same |
AU2014371934B2 (en) | 2013-12-25 | 2020-01-23 | Daiichi Sankyo Company, Limited | Anti-TROP2 antibody-drug conjugate |
WO2015099127A1 (en) | 2013-12-27 | 2015-07-02 | 中外製薬株式会社 | Fgfr gatekeeper mutant gene and drug targeting same |
TWI787590B (en) | 2013-12-27 | 2022-12-21 | 日商中外製藥股份有限公司 | Purification method of antibody with low isoelectric point |
WO2015108719A1 (en) | 2014-01-14 | 2015-07-23 | The Medical College Of Wisconsin, Inc. | Targeting clptm1l for treatment and prevention of cancer |
US10179911B2 (en) | 2014-01-20 | 2019-01-15 | President And Fellows Of Harvard College | Negative selection and stringency modulation in continuous evolution systems |
JOP20200094A1 (en) | 2014-01-24 | 2017-06-16 | Dana Farber Cancer Inst Inc | Antibody molecules to pd-1 and uses thereof |
JOP20200096A1 (en) | 2014-01-31 | 2017-06-16 | Children’S Medical Center Corp | Antibody molecules to tim-3 and uses thereof |
US11648335B2 (en) | 2014-01-31 | 2023-05-16 | Wake Forest University Health Sciences | Organ/tissue decellularization, framework maintenance and recellularization |
EP3973995A1 (en) | 2014-01-31 | 2022-03-30 | Daiichi Sankyo Company, Limited | Anti-her2 antibody-drug conjugate |
WO2015120187A1 (en) | 2014-02-05 | 2015-08-13 | The University Of Chicago | Chimeric antigen receptors recognizing cancer-spevific tn glycopeptide variants |
MX370283B (en) | 2014-02-06 | 2019-12-09 | Hoffmann La Roche | Interleukin-2 fusion proteins and uses thereof. |
MX2016010360A (en) | 2014-02-11 | 2016-11-30 | Visterra Inc | Antibody moleules to dengue virus and uses thereof. |
JP2017514143A (en) | 2014-02-21 | 2017-06-01 | アッヴィ・ステムセントルクス・エル・エル・シー | Anti-DLL3 antibodies and drug conjugates for use in melanoma |
US9732154B2 (en) | 2014-02-28 | 2017-08-15 | Janssen Biotech, Inc. | Anti-CD38 antibodies for treatment of acute lymphoblastic leukemia |
US10464955B2 (en) | 2014-02-28 | 2019-11-05 | Hangzhou Dac Biotech Co., Ltd. | Charged linkers and their uses for conjugation |
GB201403775D0 (en) | 2014-03-04 | 2014-04-16 | Kymab Ltd | Antibodies, uses & methods |
AU2015227054A1 (en) | 2014-03-05 | 2016-09-22 | Adaptive Biotechnologies Corporation | Methods using randomer-containing synthetic molecules |
WO2015136469A1 (en) | 2014-03-12 | 2015-09-17 | Prothena Biosciences Limited | Anti-mcam antibodies and associated methods of use |
EP3116907A1 (en) | 2014-03-12 | 2017-01-18 | Prothena Biosciences Limited | Anti-laminin4 antibodies specific for lg4-5 |
TW201623331A (en) | 2014-03-12 | 2016-07-01 | 普羅帝納生物科學公司 | Anti-MCAM antibodies and associated methods of use |
KR20160131082A (en) | 2014-03-12 | 2016-11-15 | 프로테나 바이오사이언시즈 리미티드 | Anti-laminin4 antibodies specific for lg1-3 |
US9738702B2 (en) | 2014-03-14 | 2017-08-22 | Janssen Biotech, Inc. | Antibodies with improved half-life in ferrets |
CN106103484B (en) | 2014-03-14 | 2021-08-20 | 诺华股份有限公司 | Antibody molecules against LAG-3 and uses thereof |
EP3122869B2 (en) | 2014-03-24 | 2022-08-10 | Biogen MA Inc. | Methods for overcoming glutamine deprivation during mammalian cell culture |
KR20160138494A (en) | 2014-03-31 | 2016-12-05 | 데비오팜 인터네셔날 에스 에이 | Fgfr fusions |
US10066265B2 (en) | 2014-04-01 | 2018-09-04 | Adaptive Biotechnologies Corp. | Determining antigen-specific t-cells |
CN106536556B (en) | 2014-04-04 | 2020-02-07 | 生态学有限公司 | Humanized antibodies that bind LGR5 |
KR102546611B1 (en) | 2014-04-08 | 2023-06-22 | 보스턴 파마슈티칼즈, 아이엔씨. | Binding molecules specific for il-21 and uses of thereof |
US10562973B2 (en) | 2014-04-08 | 2020-02-18 | Prothena Bioscience Limited | Blood-brain barrier shuttles containing antibodies recognizing alpha-synuclein |
NZ722668A (en) | 2014-04-10 | 2024-02-23 | Daiichi Sankyo Europe Gmbh | Anti-her3 antibody-drug conjugate |
US10160812B2 (en) | 2014-04-11 | 2018-12-25 | Medimmune, Llc | Bispecific HER2 antibodies |
GB201406767D0 (en) | 2014-04-15 | 2014-05-28 | Cancer Rec Tech Ltd | Humanized anti-Tn-MUC1 antibodies anf their conjugates |
EP3132059B1 (en) | 2014-04-17 | 2020-01-08 | Adaptive Biotechnologies Corporation | Quantification of adaptive immune cell genomes in a complex mixture of cells |
JP6998658B2 (en) * | 2014-04-17 | 2022-01-18 | ユニバーシティ オブ メリーランド, カレッジ パーク | Devices for detecting amino acid metabolism disorders, and methods of using the devices |
TW201622746A (en) | 2014-04-24 | 2016-07-01 | 諾華公司 | Methods of improving or accelerating physical recovery after surgery for hip fracture |
WO2015164364A2 (en) | 2014-04-25 | 2015-10-29 | The Brigham And Women's Hospital, Inc. | Methods to manipulate alpha-fetoprotein (afp) |
US9753036B2 (en) | 2014-04-29 | 2017-09-05 | Edp Biotech Corporation | Methods and compositions for screening and detecting biomarkers |
AU2015254558B2 (en) | 2014-05-02 | 2021-02-25 | Medimmune Limited | Ion channel modulators and uses thereof |
CA2946606C (en) | 2014-05-13 | 2023-06-06 | Bavarian Nordic A/S | Combination therapy for treating cancer with a poxvirus expressing a tumor antigen and an antagonist of tim-3 |
CN106413750B (en) | 2014-05-16 | 2022-04-29 | 免疫医疗有限责任公司 | Molecules with altered neonatal Fc receptor binding with enhanced therapeutic and diagnostic properties |
US10302653B2 (en) | 2014-05-22 | 2019-05-28 | Mayo Foundation For Medical Education And Research | Distinguishing antagonistic and agonistic anti B7-H1 antibodies |
MA47849A (en) | 2014-05-28 | 2020-01-29 | Agenus Inc | ANTI-GITR ANTIBODIES AND THEIR METHODS OF USE |
GB201409558D0 (en) | 2014-05-29 | 2014-07-16 | Ucb Biopharma Sprl | Method |
SG10201703965SA (en) | 2014-06-03 | 2017-06-29 | Xbiotech Inc | Compositions and methods for treating and preventing staphylococcus aureus infections |
PT3154583T (en) | 2014-06-04 | 2021-03-24 | Biontech Res And Development Inc | Human monoclonal antibodies to ganglioside gd2 |
EA037006B1 (en) | 2014-06-06 | 2021-01-26 | Бристол-Майерс Сквибб Компани | Antibodies against glucocorticoid-induced tumor necrosis factor receptor (gitr) and uses thereof |
MX2016016310A (en) | 2014-06-11 | 2017-10-20 | A Green Kathy | Use of vista agonists and antagonists to suppress or enhance humoral immunity. |
WO2015189816A1 (en) | 2014-06-13 | 2015-12-17 | Friedrich Miescher Institute For Biomedical Research | New treatment against influenza virus |
TWI695011B (en) | 2014-06-18 | 2020-06-01 | 美商梅爾莎納醫療公司 | Monoclonal antibodies against her2 epitope and methods of use thereof |
TWI713453B (en) | 2014-06-23 | 2020-12-21 | 美商健生生物科技公司 | Interferon alpha and omega antibody antagonists |
US10308935B2 (en) | 2014-06-23 | 2019-06-04 | Friedrich Miescher Institute For Biomedical Research | Methods for triggering de novo formation of heterochromatin and or epigenetic silencing with small RNAS |
WO2015198240A2 (en) | 2014-06-25 | 2015-12-30 | Novartis Ag | Compositions and methods for long acting proteins |
EP3161001A2 (en) | 2014-06-25 | 2017-05-03 | Novartis AG | Antibodies specific for il-17a fused to hyaluronan binding peptide tags |
GB201411320D0 (en) | 2014-06-25 | 2014-08-06 | Ucb Biopharma Sprl | Antibody construct |
WO2015198243A2 (en) | 2014-06-25 | 2015-12-30 | Novartis Ag | Compositions and methods for long acting proteins |
CA2953807A1 (en) | 2014-06-26 | 2015-12-30 | Yale University | Compositions and methods to regulate renalase in the treatment of diseases and disorders |
US9840553B2 (en) | 2014-06-28 | 2017-12-12 | Kodiak Sciences Inc. | Dual PDGF/VEGF antagonists |
SG11201609707WA (en) | 2014-07-01 | 2017-01-27 | Pfizer | Bispecific heterodimeric diabodies and uses thereof |
US20170165261A1 (en) | 2014-07-01 | 2017-06-15 | Brian Arthur Hemmings | Combination of a brafv600e inhibitor and mertk inhibitor to treat melanoma |
US9139648B1 (en) | 2014-07-15 | 2015-09-22 | Kymab Limited | Precision medicine by targeting human NAV1.9 variants for treatment of pain |
GB201412659D0 (en) | 2014-07-16 | 2014-08-27 | Ucb Biopharma Sprl | Molecules |
WO2016008112A1 (en) | 2014-07-16 | 2016-01-21 | Medshine Discovery Inc. | Linkers and application towards adc thereof |
GB201412658D0 (en) | 2014-07-16 | 2014-08-27 | Ucb Biopharma Sprl | Molecules |
MY178347A (en) | 2014-07-17 | 2020-10-08 | Novo Nordisk As | Site directed mutagenesis of trem-1 antibodies for decreasing viscosity |
CN112481283A (en) | 2014-07-21 | 2021-03-12 | 诺华股份有限公司 | Treatment of cancer using CD33 chimeric antigen receptor |
US10517875B2 (en) | 2014-07-23 | 2019-12-31 | Mayo Foundation for Medical Engineering and Research | Targeting DNA-PKcs and B7-H1 to treat cancer |
EP3172228B1 (en) | 2014-07-25 | 2019-02-27 | Theravectys | Lentiviral vectors for regulated expression of a chimeric antigen receptor molecule |
PE20170263A1 (en) | 2014-08-04 | 2017-03-30 | Hoffmann La Roche | T-CELL ACTIVATING ANTIGEN-BINDING BI-SPECIFIC MOLECULES |
EP3194437B1 (en) | 2014-08-07 | 2021-01-20 | Novartis AG | Angiopoietin-like 4 (angptl4) antibodies and methods of use |
CN107148428B (en) | 2014-08-07 | 2021-03-09 | 诺华股份有限公司 | Angiopoietin-like protein 4 antibodies and methods of use |
WO2016025880A1 (en) | 2014-08-14 | 2016-02-18 | Novartis Ag | Treatment of cancer using gfr alpha-4 chimeric antigen receptor |
MY189028A (en) | 2014-08-19 | 2022-01-20 | Novartis Ag | Anti-cd123 chimeric antigen receptor (car) for use in cancer treatment |
EP3185004A4 (en) | 2014-08-20 | 2018-05-30 | Chugai Seiyaku Kabushiki Kaisha | Method for measuring viscosity of protein solution |
EP3183002B1 (en) | 2014-08-21 | 2021-03-03 | Walter Reed Army Institute of Research | Monoclonal antibodies for treatment of microbial infections |
JP2017527562A (en) | 2014-09-03 | 2017-09-21 | イミュノジェン・インコーポレーテッド | Cytotoxic benzodiazepine derivatives |
ES2815353T3 (en) | 2014-09-03 | 2021-03-29 | Immunogen Inc | Cytotoxic benzodiazepine derivatives |
US10724096B2 (en) | 2014-09-05 | 2020-07-28 | Population Bio, Inc. | Methods and compositions for inhibiting and treating neurological conditions |
US10442863B2 (en) | 2014-09-08 | 2019-10-15 | Lutana Gmbh | Construct for the delivery of a molecule into the cytoplasm of a cell |
SG11201701867SA (en) | 2014-09-09 | 2017-04-27 | Janssen Biotech Inc | Combination therapies with anti-cd38 antibodies |
US20160075772A1 (en) | 2014-09-12 | 2016-03-17 | Regeneron Pharmaceuticals, Inc. | Treatment of Fibrodysplasia Ossificans Progressiva |
US9993551B2 (en) | 2014-09-13 | 2018-06-12 | Novartis Ag | Combination therapies of EGFR inhibitors |
CA2960756C (en) | 2014-09-15 | 2023-08-01 | Amgen Inc. | Bi-specific anti-cgrp receptor/pac1 receptor antigen binding proteins and uses thereof |
ES2748295T3 (en) | 2014-09-16 | 2020-03-16 | Symphogen As | Anti-MET antibodies and compositions |
WO2016046768A1 (en) | 2014-09-24 | 2016-03-31 | Friedrich Miescher Institute For Biomedical Research | Lats and breast cancer |
MA40764A (en) | 2014-09-26 | 2017-08-01 | Chugai Pharmaceutical Co Ltd | THERAPEUTIC AGENT INDUCING CYTOTOXICITY |
AU2015327064B2 (en) | 2014-09-30 | 2021-03-18 | Deutsches Krebsforschungszentrum Stiftung des öffentlichen Rechts | Binding molecules, especially antibodies, binding to L1CAM (CD171) |
CN106715473B (en) | 2014-10-01 | 2021-11-23 | 免疫医疗有限公司 | Antibodies to ticagrelor and methods of use thereof |
KR20170066546A (en) | 2014-10-03 | 2017-06-14 | 노파르티스 아게 | Combination therapies |
AU2015327819B2 (en) | 2014-10-03 | 2021-07-01 | Massachusetts Institute Of Technology | Antibodies that bind ebola glycoprotein and uses thereof |
CU20170052A7 (en) | 2014-10-14 | 2017-11-07 | Dana Farber Cancer Inst Inc | ANTIBODY MOLECULES THAT JOIN PD-L1 |
MX2017004769A (en) | 2014-10-15 | 2017-10-16 | Amgen Inc | Promoter and regulatory elements for improved expression of heterologous genes in host cells. |
MA41685A (en) | 2014-10-17 | 2017-08-22 | Biogen Ma Inc | COPPER SUPPLEMENT FOR THE REGULATION OF GLYCOSYLATION IN A MAMMAL CELL CULTURE PROCESS |
KR20210013299A (en) | 2014-10-17 | 2021-02-03 | 코디악 사이언시스 인코포레이티드 | Butyrylcholinesterase zwitterionic polymer conjugates |
US10920208B2 (en) | 2014-10-22 | 2021-02-16 | President And Fellows Of Harvard College | Evolution of proteases |
WO2016069886A1 (en) | 2014-10-29 | 2016-05-06 | Adaptive Biotechnologies Corporation | Highly-multiplexed simultaneous detection of nucleic acids encoding paired adaptive immune receptor heterodimers from many samples |
SG11201703446RA (en) | 2014-10-31 | 2017-05-30 | Abbvie Biotherapeutics Inc | Anti-cs1 antibodies and antibody drug conjugates |
MA40864A (en) | 2014-10-31 | 2017-09-05 | Biogen Ma Inc | HYPOTAURINE, GABA, BETA-ALANINE AND CHOLINE FOR THE REGULATION OF THE ACCUMULATION OF RESIDUAL BY-PRODUCTS IN MAMMAL CELL CULTURE PROCESSES |
WO2016073401A1 (en) | 2014-11-03 | 2016-05-12 | Bristol-Myers Squibb Company | Use of caprylic acid precipitation for protein purification |
KR102626877B1 (en) | 2014-11-05 | 2024-01-19 | 애넥슨, 인코포레이티드 | Humanized Anti-Complement Factor C1Q Antibodies and Uses Thereof |
WO2016073157A1 (en) | 2014-11-06 | 2016-05-12 | Genentech, Inc. | Anti-ang2 antibodies and methods of use thereof |
WO2016073894A1 (en) | 2014-11-07 | 2016-05-12 | Eleven Biotherapeutics, Inc. | Therapeutic agents with increased ocular retention |
CA2967026A1 (en) | 2014-11-07 | 2016-05-12 | Mayo Foundation For Medical Education And Research | Treatment of neonatal hypoxia including impairments or effects thereof |
ES2756275T3 (en) | 2014-11-07 | 2020-04-27 | Sesen Bio Inc | Enhanced anti-IL-6 antibodies |
AU2015345202B2 (en) | 2014-11-10 | 2021-05-13 | Medimmune Limited | Binding molecules specific for CD73 and uses thereof |
JP6847037B2 (en) | 2014-11-11 | 2021-03-24 | メディミューン リミテッド | Concomitant therapeutic agents containing anti-CD73 antibody and A2A receptor inhibitor and their use |
EP4183806A3 (en) | 2014-11-12 | 2023-08-02 | Seagen Inc. | Glycan-interacting compounds and methods of use |
US9879087B2 (en) | 2014-11-12 | 2018-01-30 | Siamab Therapeutics, Inc. | Glycan-interacting compounds and methods of use |
US10246701B2 (en) | 2014-11-14 | 2019-04-02 | Adaptive Biotechnologies Corp. | Multiplexed digital quantitation of rearranged lymphoid receptors in a complex mixture |
EP3224275B1 (en) | 2014-11-14 | 2020-03-04 | F.Hoffmann-La Roche Ag | Antigen binding molecules comprising a tnf family ligand trimer |
EA201791093A1 (en) | 2014-11-18 | 2018-04-30 | Янссен Фармацевтика Нв | ANTIBODIES TO CD47, METHODS AND USE |
BR112017010268B1 (en) | 2014-11-19 | 2024-01-16 | P & M Venge Ab | BINDING AGENT, DIAGNOSTIC COMPOSITION, DIAGNOSTIC KIT, METHOD OF DIAGNOSING A BACTERIAL INFECTION OR OF DIFFERENTIATION BETWEEN A BACTERIAL INFECTION AND A VIRAL INFECTION, METHODS FOR RULED OUT A BACTERIAL OR VIRAL INFECTION IN AN INDIVIDUAL, METHODS FOR CONSIDERING AN INFECTION BACTERIAL ACTION OR VIRAL IN AN INDIVIDUAL, METHOD FOR DISTINGUISHING BETWEEN A BACTERIAL OR MIXED INFECTION AND A VIRAL INFECTION IN AN INDIVIDUAL, METHOD FOR RULING OUT AN INFECTIOUS DISEASE, METHOD FOR IDENTIFYING THE TYPE OF INFECTION AND DEVICE FOR DIAGNOSING BACTERIAL INFECTIONS |
MA40934A (en) | 2014-11-19 | 2017-09-27 | Immunogen Inc | PROCESS FOR PREPARATION OF CELL BONDING AGENT-CYTOTOXIC AGENT CONJUGATES |
PL3221357T3 (en) | 2014-11-20 | 2020-11-02 | F. Hoffmann-La Roche Ag | Common light chains and methods of use |
RS60631B1 (en) | 2014-11-21 | 2020-09-30 | Bristol Myers Squibb Co | Antibodies against cd73 and uses thereof |
ES2832802T3 (en) | 2014-11-21 | 2021-06-11 | Univ Maryland | Systems of directed administration of the specific particulate of a structure |
EP3227332B1 (en) | 2014-12-03 | 2019-11-06 | F.Hoffmann-La Roche Ag | Multispecific antibodies |
EP3226900A4 (en) | 2014-12-05 | 2018-09-19 | Immunext, Inc. | Identification of vsig8 as the putative vista receptor and its use thereof to produce vista/vsig8 modulators |
CA2968352A1 (en) | 2014-12-08 | 2016-06-16 | Dana-Farber Cancer Institute, Inc. | Methods for upregulating immune responses using combinations of anti-rgmb and anti-pd-1 agents |
CA2970155A1 (en) | 2014-12-09 | 2016-06-16 | Abbvie Inc. | Bcl-xl inhibitory compounds having low cell permeability and antibody drug conjugates including the same |
BR112017012377A2 (en) | 2014-12-09 | 2018-04-24 | Abbvie Inc | antibody-drug conjugates with cell-permeable bcl-x1 inhibitors |
EP3229838B1 (en) | 2014-12-11 | 2020-09-09 | Pierre Fabre Medicament | Anti-c10orf54 antibodies and uses thereof |
CA2967224C (en) | 2014-12-11 | 2023-08-22 | Inbiomotion S.L. | Binding members for human c-maf |
US10093733B2 (en) | 2014-12-11 | 2018-10-09 | Abbvie Inc. | LRP-8 binding dual variable domain immunoglobulin proteins |
MA41142A (en) | 2014-12-12 | 2017-10-17 | Amgen Inc | ANTI-SCLEROSTINE ANTIBODIES AND THE USE OF THEM TO TREAT BONE CONDITIONS AS PART OF THE TREATMENT PROTOCOL |
EP3233918A1 (en) | 2014-12-19 | 2017-10-25 | Novartis AG | Combination therapies |
PT3233912T (en) | 2014-12-19 | 2021-08-09 | Regenesance B V | Antibodies that bind human c6 and uses thereof |
UY36449A (en) | 2014-12-19 | 2016-07-29 | Novartis Ag | COMPOSITIONS AND METHODS FOR ANTIBODIES DIRECTED TO BMP6 |
EP3789039A1 (en) | 2014-12-22 | 2021-03-10 | The Rockefeller University | Anti-mertk agonistic antibodies and uses thereof |
TWI708786B (en) | 2014-12-23 | 2020-11-01 | 美商必治妥美雅史谷比公司 | Antibodies to tigit |
MX2017009038A (en) | 2015-01-08 | 2017-10-25 | Biogen Ma Inc | Lingo-1 antagonists and uses for treatment of demyelinating disorders. |
CA2973978A1 (en) | 2015-01-14 | 2016-07-21 | The Brigham And Women's Hospital, Inc. | Treatment of cancer with anti-lap monoclonal antibodies |
US10736956B2 (en) | 2015-01-23 | 2020-08-11 | Icahn School Of Medicine At Mount Sinai | Influenza virus vaccination regimens |
JP6912386B2 (en) | 2015-01-26 | 2021-08-04 | ザ ユニバーシティー オブ シカゴ | CAR T cells that recognize cancer-specific IL13Rα2 |
JP7264592B2 (en) | 2015-01-26 | 2023-04-25 | ザ ユニバーシティー オブ シカゴ | IL13Rα2 BINDING AGENTS AND THEIR USE IN CANCER THERAPY |
TWI786505B (en) | 2015-01-28 | 2022-12-11 | 愛爾蘭商普羅佘納生物科技有限公司 | Anti-transthyretin antibodies |
TWI718121B (en) | 2015-01-28 | 2021-02-11 | 愛爾蘭商普羅佘納生物科技有限公司 | Anti-transthyretin antibodies |
TWI769570B (en) | 2015-01-28 | 2022-07-01 | 愛爾蘭商普羅佘納生物科技有限公司 | Anti-transthyretin antibodies |
CA3185253A1 (en) | 2015-02-02 | 2016-08-11 | Children's Health Care D/B/A Children's Minnesota | Anti-surrogate light chain antibodies |
CA2976074A1 (en) | 2015-02-09 | 2016-08-18 | Memorial Sloan Kettering Cancer Center | Multi-specific antibodies with affinity for human a33 antigen and dota metal complex and uses thereof |
US10266584B2 (en) | 2015-02-09 | 2019-04-23 | Inserm (Institut National De La Sante Et De La Recherche Medicale) | Antibodies specific to glycoprotein (GP) of Ebolavirus and uses for the treatment and diagnosis of ebola virus infection |
EP3262070A4 (en) * | 2015-02-24 | 2018-07-25 | Rpeptide, LLC | Anti-amyloid-beta antibodies |
TWI805046B (en) | 2015-02-27 | 2023-06-11 | 日商中外製藥股份有限公司 | Use of IL-6 receptor antibody for preparing pharmaceutical composition |
EP3265491A1 (en) | 2015-03-03 | 2018-01-10 | Xoma (Us) Llc | Treatment of post-prandial hyperinsulinemia and hypoglycemia after bariatric surgery |
WO2016139482A1 (en) | 2015-03-03 | 2016-09-09 | Kymab Limited | Antibodies, uses & methods |
EP3265483B1 (en) | 2015-03-06 | 2019-12-11 | CSL Behring Lengnau AG | Modified von willebrand factor having improved half-life |
EP3735982A1 (en) | 2015-03-10 | 2020-11-11 | The University of Massachusetts | Targeting gdf6 and bmp signaling for anti-melanoma therapy |
AU2016233557B2 (en) | 2015-03-13 | 2021-06-24 | Bristol-Myers Squibb Company | Use of alkaline washes during chromatography to remove impurities |
WO2016146833A1 (en) | 2015-03-19 | 2016-09-22 | F. Hoffmann-La Roche Ag | Biomarkers for nad(+)-diphthamide adp ribosyltransferase resistance |
US20180105554A1 (en) | 2015-03-20 | 2018-04-19 | Bristol-Myers Squibb Company | Use of dextran sulfate to enhance protein a affinity chromatography |
US20180105555A1 (en) | 2015-03-20 | 2018-04-19 | Bristol-Myers Squibb Company | Use of dextran for protein purification |
EP3274468B1 (en) | 2015-03-25 | 2019-02-20 | Alexion Pharmaceuticals, Inc. | A method for measuring the protease activity of c3 and c5 convertase of the alternative complement pathway |
WO2016151558A1 (en) | 2015-03-25 | 2016-09-29 | Alexion Pharmaceuticals, Inc. | A method for measuring the protease activity of factor d of the alternative complement pathway |
CA2981142A1 (en) | 2015-03-27 | 2016-10-06 | University Of Southern California | Car t-cell therapy directed to lhr for the treatment of solid tumors |
KR102622281B1 (en) | 2015-03-31 | 2024-01-08 | 소리소 파마슈티컬스 인크. | polypeptide |
EP3277706A1 (en) | 2015-03-31 | 2018-02-07 | VHsquared Limited | Polypeptide comprising an immunoglobulin chain variable domain which binds to clostridium difficile toxin b |
EP3277717B1 (en) | 2015-03-31 | 2020-11-18 | Medimmune Limited | A novel il33 form, mutated forms of il33, antibodies, assays and methods of using the same |
WO2016161410A2 (en) | 2015-04-03 | 2016-10-06 | Xoma Technology Ltd. | Treatment of cancer using inhibitors of tgf-beta and pd-1 |
CN107969128A (en) | 2015-04-17 | 2018-04-27 | 高山免疫科学股份有限公司 | Immune modulator with adjustable affinity |
WO2016168755A1 (en) | 2015-04-17 | 2016-10-20 | Distributed Bio, Inc. | Method for mass humanization of non-human antibodies |
US11299729B2 (en) | 2015-04-17 | 2022-04-12 | President And Fellows Of Harvard College | Vector-based mutagenesis system |
US10954515B2 (en) | 2015-04-21 | 2021-03-23 | Institut Gustave Roussy | Therapeutic methods, products and compositions inhibiting ZNF555 |
GB201506869D0 (en) | 2015-04-22 | 2015-06-03 | Ucb Biopharma Sprl | Method |
GB201506870D0 (en) | 2015-04-22 | 2015-06-03 | Ucb Biopharma Sprl | Method |
WO2016172726A1 (en) | 2015-04-24 | 2016-10-27 | The Regents Of The University Of California | Modulators of ror1-ror2 binding |
AU2016256486B2 (en) | 2015-04-29 | 2021-09-23 | University Of South Australia | Compositions and methods for administering antibodies |
EP3288976B1 (en) | 2015-04-29 | 2020-04-08 | Regeneron Pharmaceuticals, Inc. | Treatment of fibrodysplasia ossificans progressiva |
WO2016173719A1 (en) | 2015-04-30 | 2016-11-03 | Abcheck S.R.O. | Method for mass humanization of rabbit antibodies |
WO2016179518A2 (en) | 2015-05-06 | 2016-11-10 | Janssen Biotech, Inc. | Prostate specific membrane antigen (psma) bispecific binding agents and uses thereof |
SG11201708804WA (en) | 2015-05-07 | 2017-11-29 | Agenus Inc | Anti-ox40 antibodies and methods of use thereof |
US10900975B2 (en) | 2015-05-12 | 2021-01-26 | Arizona Board Of Regents On Behalf Of Arizona State University | Systems and methods of epitope binning and antibody profiling |
WO2016187068A1 (en) | 2015-05-15 | 2016-11-24 | The General Hospital Corporation | Antagonistic anti-tumor necrosis factor receptor superfamily antibodies |
EP3095465A1 (en) | 2015-05-19 | 2016-11-23 | U3 Pharma GmbH | Combination of fgfr4-inhibitor and bile acid sequestrant |
IL300548A (en) | 2015-05-20 | 2023-04-01 | Janssen Biotech Inc | Anti-cd38 antibodies for treatment of light chain amyloidosis and other cd38-positive hematological malignancies |
EA039951B1 (en) | 2015-05-27 | 2022-03-31 | Юсб Биофарма Спрл | Inhibitor of csf-1r activity for use in the treatment or prophylaxis of epilepsy or parkinson's disease and pharmaceutical composition thereof |
HUE048284T2 (en) | 2015-05-29 | 2020-07-28 | Abbvie Inc | Anti-cd40 antibodies and uses thereof |
SG10201913500TA (en) | 2015-05-29 | 2020-03-30 | Agenus Inc | Anti-ctla-4 antibodies and methods of use thereof |
CA2987410A1 (en) | 2015-05-29 | 2016-12-08 | Bristol-Myers Squibb Company | Antibodies against ox40 and uses thereof |
EP3302559B1 (en) | 2015-06-04 | 2022-01-12 | University of Southern California | Lym-1 and lym-2 targeted car cell immunotherapy |
PE20180041A1 (en) | 2015-06-05 | 2018-01-09 | Novartis Ag | ANTIBODIES TARGETING BONE MORPHOGENETIC PROTEIN (BMP9) AND METHODS FROM THESE |
US10723793B2 (en) | 2015-06-12 | 2020-07-28 | Ludwig Institute For Cancer Research, Ltd. | TGF-β3 specific antibodies and methods and uses thereof |
TW201710286A (en) | 2015-06-15 | 2017-03-16 | 艾伯維有限公司 | Binding proteins against VEGF, PDGF, and/or their receptors |
GB201510758D0 (en) | 2015-06-18 | 2015-08-05 | Ucb Biopharma Sprl | Novel TNFa structure for use in therapy |
EA036789B1 (en) | 2015-06-22 | 2020-12-22 | Янссен Байотек, Инк. | Combination therapies for heme malignancies with anti-cd38 antibodies and survivin inhibitors |
UA124799C2 (en) | 2015-06-24 | 2021-11-24 | Янссен Байотек, Інк. | Immune modulation and treatment of solid tumors with antibodies that specifically bind cd38 |
JP7026509B2 (en) | 2015-06-24 | 2022-02-28 | ヤンセン ファーマシューティカ エヌブイ | Anti-VISTA antibody and fragment |
KR20180021723A (en) | 2015-06-29 | 2018-03-05 | 다이이찌 산쿄 가부시키가이샤 | Method for selectively manufacturing antibody-drug conjugate |
AU2016285920A1 (en) | 2015-06-29 | 2018-02-01 | Bristol-Myers Squibb Company | Antibodies to CD40 with enhanced agonist activity |
HUE053619T2 (en) | 2015-06-29 | 2021-07-28 | Immunogen Inc | Anti-cd123 antibodies and conjugates and derivatives thereof |
CN113350518A (en) | 2015-07-12 | 2021-09-07 | 杭州多禧生物科技有限公司 | Conjugated bridge linkers to cell binding molecules |
US9839687B2 (en) | 2015-07-15 | 2017-12-12 | Suzhou M-Conj Biotech Co., Ltd. | Acetylenedicarboxyl linkers and their uses in specific conjugation of a cell-binding molecule |
GB201601077D0 (en) | 2016-01-20 | 2016-03-02 | Ucb Biopharma Sprl | Antibody molecule |
GB201601073D0 (en) | 2016-01-20 | 2016-03-02 | Ucb Biopharma Sprl | Antibodies |
GB201601075D0 (en) | 2016-01-20 | 2016-03-02 | Ucb Biopharma Sprl | Antibodies molecules |
WO2017015545A1 (en) | 2015-07-22 | 2017-01-26 | President And Fellows Of Harvard College | Evolution of site-specific recombinases |
US11524983B2 (en) | 2015-07-23 | 2022-12-13 | President And Fellows Of Harvard College | Evolution of Bt toxins |
SI3317301T1 (en) | 2015-07-29 | 2021-10-29 | Novartis Ag | Combination therapies comprising antibody molecules to lag-3 |
EP3316902A1 (en) | 2015-07-29 | 2018-05-09 | Novartis AG | Combination therapies comprising antibody molecules to tim-3 |
WO2017019895A1 (en) | 2015-07-30 | 2017-02-02 | President And Fellows Of Harvard College | Evolution of talens |
KR20180035852A (en) | 2015-08-03 | 2018-04-06 | 노파르티스 아게 | Methods for treating FGF21-associated disorders |
ES2944982T3 (en) | 2015-08-05 | 2023-06-27 | Janssen Biotech Inc | Anti-CD154 antibodies and methods of using them |
EP3152570A1 (en) | 2015-08-06 | 2017-04-12 | Yaya Diagnostics GmbH | Means and methods for the detection of targets |
CA2994841A1 (en) | 2015-08-06 | 2017-02-09 | Xoma (Us) Llc | Antibody fragments against the insulin receptor and uses thereof to treat hypoglycemia |
WO2017031353A1 (en) | 2015-08-19 | 2017-02-23 | Rutgers, The State University Of New Jersey | Novel methods of generating antibodies |
EP3341415B1 (en) | 2015-08-28 | 2021-03-24 | H. Hoffnabb-La Roche Ag | Anti-hypusine antibodies and uses thereof |
EA201890630A1 (en) | 2015-09-01 | 2018-10-31 | Эйдженус Инк. | ANTIBODIES AGAINST PD-1 AND METHODS OF THEIR APPLICATION |
AU2016315892B2 (en) | 2015-09-02 | 2023-06-15 | The Regents Of The University Of Colorado, A Body Corporate | Compositions and methods for modulating T-cell mediated immune response |
RU2731644C2 (en) | 2015-09-09 | 2020-09-07 | Новартис Аг | Molecules binding to thymic stromal lymphopoietin (tslp), and methods of using such molecules |
US10000561B2 (en) | 2015-09-09 | 2018-06-19 | Novartis Ag | Thymic stromal lymphopoietin (TSLP)-binding molecules and methods of using the molecules |
CA2997762A1 (en) | 2015-09-10 | 2017-03-16 | Becton, Dickinson And Company | Cyclophosphamide analogs for use as immunogens and assay conjugates for an immunoassay of cyclophosphamide and ifosfamide |
AU2016323440B2 (en) | 2015-09-15 | 2023-07-13 | Amgen Inc. | Tetravalent bispecific and tetraspecific antigen binding proteins and uses thereof |
LT3350220T (en) | 2015-09-15 | 2021-09-27 | Scholar Rock, Inc. | Anti-pro/latent-myostatin antibodies and uses thereof |
JP2018530540A (en) | 2015-09-16 | 2018-10-18 | プロセナ バイオサイエンシーズ リミテッド | Use of anti-MCAM antibodies for the treatment or prevention of giant cell arteritis, polymyalgia rheumatica or Takayasu arteritis |
WO2017046774A2 (en) | 2015-09-16 | 2017-03-23 | Prothena Biosciences Limited | Use of anti-mcam antibodies for treatment or prophylaxis of giant cell arteritis, polymyalgia rheumatica or takayasu's arteritis |
EP3349796A4 (en) | 2015-09-17 | 2019-05-29 | ImmunoGen, Inc. | Therapeutic combinations comprising anti-folr1 immunoconjugates |
EP3352784A4 (en) | 2015-09-23 | 2019-06-26 | Cytoimmune Therapeutics, LLC | Flt3 directed car cells for immunotherapy |
WO2017053807A2 (en) | 2015-09-23 | 2017-03-30 | Genentech, Inc. | Optimized variants of anti-vegf antibodies |
IL288784B2 (en) | 2015-09-24 | 2023-10-01 | Daiichi Sankyo Co Ltd | Anti-garp antibodies, nucleotides encoding same, vectors, cells and compositions comparising same, methods of producing same and uses thereof |
RU2638457C2 (en) | 2015-09-28 | 2017-12-13 | Общество С Ограниченной Ответственностью "Онкомакс" | Antibodies specifically binding type 1 receptor of fibroblast growth factor, antibodies application for oncological disease treatment, method for antibodies production |
CN109069622A (en) | 2015-09-30 | 2018-12-21 | 詹森生物科技公司 | Specifically bind the antagonistic antibodies and application method of people CD40 |
AR106188A1 (en) | 2015-10-01 | 2017-12-20 | Hoffmann La Roche | ANTI-CD19 HUMANIZED HUMAN ANTIBODIES AND METHODS OF USE |
JP6937746B2 (en) | 2015-10-02 | 2021-09-22 | エフ・ホフマン−ラ・ロシュ・アクチェンゲゼルシャフト | Bispecific anti-CD19 × CD3T cell-activating antigen-binding molecule |
CN107849137B (en) | 2015-10-02 | 2021-11-26 | 豪夫迈·罗氏有限公司 | Bispecific anti-CEAXCD 3T cell activating antigen binding molecules |
WO2017055385A1 (en) | 2015-10-02 | 2017-04-06 | F. Hoffmann-La Roche Ag | Anti-cd3xgd2 bispecific t cell activating antigen binding molecules |
WO2017055388A2 (en) | 2015-10-02 | 2017-04-06 | F. Hoffmann-La Roche Ag | Bispecific t cell activating antigen binding molecules |
US20170096485A1 (en) | 2015-10-02 | 2017-04-06 | Hoffmann-La Roche Inc. | Bispecific t cell activating antigen binding molecules |
WO2017055392A1 (en) | 2015-10-02 | 2017-04-06 | F. Hoffmann-La Roche Ag | Anti-cd3xcd44v6 bispecific t cell activating antigen binding molecules |
WO2017055393A1 (en) | 2015-10-02 | 2017-04-06 | F. Hoffmann-La Roche Ag | Anti-cd3xtim-3 bispecific t cell activating antigen binding molecules |
WO2017055395A1 (en) | 2015-10-02 | 2017-04-06 | F. Hoffmann-La Roche Ag | Anti-cd3xrob04 bispecific t cell activating antigen binding molecules |
US11207393B2 (en) | 2015-10-16 | 2021-12-28 | President And Fellows Of Harvard College | Regulatory T cell PD-1 modulation for regulating T cell effector immune responses |
CN108350068A (en) | 2015-10-27 | 2018-07-31 | Ucb生物制药私人有限公司 | Use the therapy of anti-IL-17A/F antibody |
US20180348224A1 (en) | 2015-10-28 | 2018-12-06 | Friedrich Miescher Institute For Biomedical Resear Ch | Tenascin-w and biliary tract cancers |
WO2017075329A2 (en) | 2015-10-29 | 2017-05-04 | Dana-Farber Cancer Institute, Inc. | Methods for identification, assessment, prevention, and treatment of metabolic disorders using pm20d1 and n-lipidated amino acids |
US10875923B2 (en) | 2015-10-30 | 2020-12-29 | Mayo Foundation For Medical Education And Research | Antibodies to B7-H1 |
JP6869553B2 (en) | 2015-10-30 | 2021-05-12 | ギャラクシー バイオテック, エルエルシーGalaxy Biotech, Llc | Very strong antibody that binds to death receptor 4 and death receptor 5. |
ITUB20155272A1 (en) | 2015-11-02 | 2017-05-02 | Scuola Normale Superiore | Intracellular antibody |
TWI800341B (en) | 2015-11-03 | 2023-04-21 | 美商健生生物科技公司 | Subcutaneous formulations of anti-cd38 antibodies and their uses |
BR112018008904A2 (en) | 2015-11-03 | 2018-11-27 | Janssen Biotech Inc | antibodies specifically binding to tim-3 and their uses |
KR20180088828A (en) | 2015-11-09 | 2018-08-07 | 더 유니버시티 오브 브리티쉬 콜롬비아 | N-terminal epitopes in amyloid beta and morphologically-selective antibodies thereto |
JP7452829B2 (en) | 2015-11-09 | 2024-03-19 | ザ・ユニバーシティ・オブ・ブリティッシュ・コロンビア | Amyloid beta epitopes and antibodies against them |
US10774120B2 (en) | 2015-11-09 | 2020-09-15 | The University Of British Columbia | Anti-amyloid beta antibodies binding to a cyclic amyloid beta peptide |
RU2710194C9 (en) | 2015-11-10 | 2020-09-14 | МЕДИММЬЮН, ЭлЭлСи | Binding molecules specific for asct2, and their use |
CA3004790A1 (en) | 2015-11-10 | 2017-05-18 | Visterra, Inc. | Lipopolysaccharide binding antibody-antimicrobial peptide conjugates and uses thereof |
IL258768B2 (en) | 2015-11-12 | 2023-11-01 | Siamab Therapeutics Inc | Glycan-interacting compounds and methods of use |
JP6925278B2 (en) | 2015-11-18 | 2021-08-25 | 中外製薬株式会社 | Method of enhancing humoral immune response |
EP3378487B1 (en) | 2015-11-18 | 2022-03-16 | Chugai Seiyaku Kabushiki Kaisha | Combination therapy using t cell redirection antigen binding molecule against cell having immunosuppressing function |
US11208483B2 (en) | 2015-11-19 | 2021-12-28 | Shanghai Kanda Biotechnology Co, Ltd. | CTLA-4 antibodies and uses thereof |
AU2016356780A1 (en) | 2015-11-19 | 2018-06-28 | Bristol-Myers Squibb Company | Antibodies against glucocorticoid-induced tumor necrosis factor receptor (GITR) and uses thereof |
MA43308A (en) | 2015-11-25 | 2018-10-03 | Visterra Inc | APRIL-BOUND ANTIBODY MOLECULES AND THEIR USES |
CA3006759A1 (en) | 2015-11-30 | 2017-06-08 | The Regents Of The University Of California | Tumor-specific payload delivery and immune activation using a human antibody targeting a highly specific tumor cell surface antigen |
WO2017095875A1 (en) | 2015-11-30 | 2017-06-08 | Bristol-Myers Squibb Company | Anti human ip-10 antibodies and their uses |
WO2017095808A1 (en) | 2015-11-30 | 2017-06-08 | Abbvie Inc. | ANTI-huLRRC15 ANTIBODY DRUG CONJUGATES AND METHODS FOR THEIR USE |
JP2019500327A (en) | 2015-11-30 | 2019-01-10 | アッヴィ・インコーポレイテッド | Anti-huLRRC15 antibody drug conjugate and method of use thereof |
AU2016365318B2 (en) | 2015-12-02 | 2024-04-18 | Board Of Regents, The University Of Texas System | Antibodies and molecules that immunospecifically bind to BTN1A1 and the therapeutic uses thereof |
KR20180100122A (en) | 2015-12-02 | 2018-09-07 | 주식회사 에스티사이언스 | Antibodies specific for glycated BTLA (B- and T-lymphocyte weakening factor) |
GB201521389D0 (en) | 2015-12-03 | 2016-01-20 | Ucb Biopharma Sprl | Method |
GB201521383D0 (en) | 2015-12-03 | 2016-01-20 | Ucb Biopharma Sprl And Ucb Celltech | Method |
GB201521382D0 (en) | 2015-12-03 | 2016-01-20 | Ucb Biopharma Sprl | Antibodies |
GB201521391D0 (en) | 2015-12-03 | 2016-01-20 | Ucb Biopharma Sprl | Antibodies |
GB201521393D0 (en) | 2015-12-03 | 2016-01-20 | Ucb Biopharma Sprl | Antibodies |
EP3386542B1 (en) | 2015-12-10 | 2020-11-18 | Katholieke Universiteit Leuven | Anti adamts13 antibodies and their use for treatment or prevention of haemorrhagic disorders due to ventricular assist device |
JP2019502695A (en) | 2015-12-17 | 2019-01-31 | ノバルティス アーゲー | Combination of antibody molecule against PD-1 and C-Met inhibitor and use thereof |
AU2016371034A1 (en) | 2015-12-17 | 2018-05-31 | Janssen Biotech, Inc. | Antibodies specifically binding HLA-DR and their uses |
CA3007671A1 (en) | 2015-12-17 | 2017-06-22 | Novartis Ag | Antibody molecules to pd-1 and uses thereof |
CA3008102A1 (en) | 2015-12-18 | 2017-06-22 | Novartis Ag | Antibodies targeting cd32b and methods of use thereof |
EP3184544A1 (en) | 2015-12-23 | 2017-06-28 | Julius-Maximilians-Universität Würzburg | Glycoprotein v inhibitors for use as coagulants |
WO2017115773A1 (en) | 2015-12-28 | 2017-07-06 | 中外製薬株式会社 | Method for promoting efficiency of purification of fc region-containing polypeptide |
RU2744860C2 (en) | 2015-12-30 | 2021-03-16 | Кодиак Сайенсиз Инк. | Antibodies and their conjugates |
CN109071645A (en) | 2016-01-08 | 2018-12-21 | 供石公司 | Anti- Promyostatin/latent flesh amicine antibody and its application method |
SG11201805493YA (en) | 2016-01-08 | 2018-07-30 | Iontas Ltd | Binding members with altered diversity scaffold domains |
WO2017121880A1 (en) | 2016-01-15 | 2017-07-20 | Philogen S.P.A | Intestinal antigens for pharmacodelivery applications |
EP3851457A1 (en) | 2016-01-21 | 2021-07-21 | Novartis AG | Multispecific molecules targeting cll-1 |
CN108601848A (en) | 2016-02-05 | 2018-09-28 | 伊缪诺金公司 | It is used to prepare the effective ways of cell binding agent-cytotoxic agent conjugate |
GB201602413D0 (en) | 2016-02-10 | 2016-03-23 | Nascient Ltd | Method |
CN116920085A (en) | 2016-02-12 | 2023-10-24 | 詹森药业有限公司 | anti-VISTA (B7H 5) antibodies |
AU2017224122B2 (en) | 2016-02-26 | 2024-04-11 | The Board Of Regents Of The University Of Texas System | Connexin (Cx) 43 hemichannel-binding antibodies and uses thereof |
CN109476731A (en) | 2016-02-29 | 2019-03-15 | 基础医药有限公司 | The method for the treatment of cancer |
WO2017149513A1 (en) | 2016-03-03 | 2017-09-08 | Prothena Biosciences Limited | Anti-mcam antibodies and associated methods of use |
SG11201807677YA (en) | 2016-03-04 | 2018-10-30 | Univ Rockefeller | Antibodies to cd40 with enhanced agonist activity |
EA201891983A8 (en) | 2016-03-04 | 2020-05-28 | Бристол-Майерс Сквибб Компани | COMBINED THERAPY BY ANTIBODIES TO CD73 |
WO2017153955A1 (en) | 2016-03-09 | 2017-09-14 | Prothena Biosciences Limited | Use of anti-mcam antibodies for treatment or prophylaxis of granulomatous lung diseases |
WO2017153953A1 (en) | 2016-03-09 | 2017-09-14 | Prothena Biosciences Limited | Use of anti-mcam antibodies for treatment or prophylaxis of granulomatous lung diseases |
GB201604124D0 (en) | 2016-03-10 | 2016-04-27 | Ucb Biopharma Sprl | Pharmaceutical formulation |
SG11201807523PA (en) | 2016-03-10 | 2018-09-27 | Viela Bio Inc | Ilt7 binding molecules and methods of using the same |
WO2017156488A2 (en) | 2016-03-10 | 2017-09-14 | Acceleron Pharma, Inc. | Activin type 2 receptor binding proteins and uses thereof |
PL3365368T3 (en) | 2016-03-11 | 2023-08-21 | Scholar Rock, Inc. | Tgfbeta1-binding immunoglobulins and use thereof |
WO2017160599A1 (en) | 2016-03-14 | 2017-09-21 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Use of cd300b antagonists to treat sepsis and septic shock |
TW202342540A (en) | 2016-03-14 | 2023-11-01 | 日商中外製藥股份有限公司 | Cell injury inducing therapeutic drug for use in cancer therapy |
US10947317B2 (en) | 2016-03-15 | 2021-03-16 | Mersana Therapeutics, Inc. | NaPi2b-targeted antibody-drug conjugates and methods of use thereof |
KR20180119670A (en) | 2016-03-15 | 2018-11-02 | 아스트라제네카 아베 | Combinations of BACE inhibitors and antibody or antigen binding fragments for the treatment of diseases associated with the accumulation of amyloid beta |
EP3430058A4 (en) | 2016-03-15 | 2019-10-23 | Generon (Shanghai) Corporation Ltd. | Multispecific fab fusion proteins and use thereof |
SG11201807148RA (en) | 2016-03-16 | 2018-09-27 | Merrimack Pharmaceuticals Inc | Ephrin receptor a2 (epha2)-targeted docetaxel-generating nano-liposome compositions |
WO2017161071A1 (en) | 2016-03-16 | 2017-09-21 | Merrimack Pharmaceuticals, Inc | Treating ephrin receptor a2 (epha2) positive cancer with targeted docetaxel-generating nano-liposome compositions |
WO2017158084A1 (en) | 2016-03-17 | 2017-09-21 | Numab Innovation Ag | ANTI-TNFα-ANTIBODIES AND FUNCTIONAL FRAGMENTS THEREOF |
US11186641B2 (en) | 2016-03-17 | 2021-11-30 | Oslo Universitetssykehus Hf | Fusion proteins targeting tumour associated macrophages for treating cancer |
WO2017161342A1 (en) | 2016-03-17 | 2017-09-21 | Cedars-Sinai Medical Center | Methods of diagnosing inflammatory bowel disease through rnaset2 |
US10774140B2 (en) | 2016-03-17 | 2020-09-15 | Numab Therapeutics AG | Anti-TNFα-antibodies and functional fragments thereof |
RS61374B1 (en) | 2016-03-17 | 2021-02-26 | Tillotts Pharma Ag | Anti-tnf alpha-antibodies and functional fragments thereof |
LT3219727T (en) | 2016-03-17 | 2021-02-10 | Tillotts Pharma Ag | Anti-tnf alpha-antibodies and functional fragments thereof |
KR102392746B1 (en) | 2016-03-17 | 2022-04-29 | 누맙 이노베이션 아게 | Anti-TNFα-antibodies and functional fragments thereof |
CN109153728A (en) | 2016-03-21 | 2019-01-04 | 埃尔斯塔治疗公司 | Polyspecific and polyfunctional molecule and application thereof |
SG11201808085WA (en) | 2016-03-22 | 2018-10-30 | Hoffmann La Roche | Protease-activated t cell bispecific molecules |
US10745487B2 (en) | 2016-03-22 | 2020-08-18 | Bionomics Limited | Method of treating cancer by administering an anti-LGR5 monoclonal antibody |
JP7155009B2 (en) | 2016-03-25 | 2022-10-18 | ビステラ, インコーポレイテッド | Preparation of antibody molecules against dengue virus |
EP3231813A1 (en) | 2016-03-29 | 2017-10-18 | F. Hoffmann-La Roche AG | Trimeric costimulatory tnf family ligand-containing antigen binding molecules |
EP3943508B1 (en) | 2016-03-29 | 2024-01-10 | Board Of Regents, The University Of Texas System | Dual function antibodies specific to glycosylated pd-l1 and methods of use thereof |
EP3436480A4 (en) | 2016-03-30 | 2019-11-27 | Musc Foundation for Research Development | Methods for treatment and diagnosis of cancer by targeting glycoprotein a repetitions predominant (garp) and for providing effective immunotherapy alone or in combination |
PT3440208T (en) | 2016-04-06 | 2020-12-04 | Zumutor Biologics Inc | Vectors for cloning and expression of proteins, methods and applications thereof |
CN116333140A (en) | 2016-04-08 | 2023-06-27 | 埃缇健康公司D/B/A泽尔拜尔 | Reticulin-1 binding antibodies and uses thereof |
RU2021111187A (en) | 2016-04-15 | 2021-04-29 | Янссен Фармасьютикалз, Инк. | ANTIBODIES AGAINST HUMAN VISTA AND THEIR APPLICATION |
US20170298119A1 (en) | 2016-04-15 | 2017-10-19 | Visterra, Inc. | Antibody molecules to zika virus and uses thereof |
MA44723A (en) | 2016-04-18 | 2019-02-27 | Celldex Therapeutics Inc | HUMAN CD40 BINDING AGONIST ANTIBODIES AND THEIR USES |
WO2017182561A1 (en) | 2016-04-21 | 2017-10-26 | Sphingotec Therapeutics Gmbh | Methods for determining dpp3 and therapeutic methods |
KR102471787B1 (en) | 2016-05-02 | 2022-11-29 | 프로테나 바이오사이언시즈 리미티드 | Tau recognition antibody |
CN109415434B (en) | 2016-05-02 | 2022-12-30 | 普罗塞纳生物科学有限公司 | Antibodies recognizing TAU |
EP3455256A1 (en) | 2016-05-09 | 2019-03-20 | Bristol-Myers Squibb Company | Tl1a antibodies and uses thereof |
EP3243836A1 (en) | 2016-05-11 | 2017-11-15 | F. Hoffmann-La Roche AG | C-terminally fused tnf family ligand trimer-containing antigen binding molecules |
WO2017194442A1 (en) | 2016-05-11 | 2017-11-16 | F. Hoffmann-La Roche Ag | Antigen binding molecules comprising a tnf family ligand trimer and a tenascin binding moiety |
EP3243832A1 (en) | 2016-05-13 | 2017-11-15 | F. Hoffmann-La Roche AG | Antigen binding molecules comprising a tnf family ligand trimer and pd1 binding moiety |
JP7084878B2 (en) | 2016-05-16 | 2022-06-15 | 武田薬品工業株式会社 | Anti-factor IX Padua antibody |
KR20230028574A (en) | 2016-05-17 | 2023-02-28 | 애브비 바이오테라퓨틱스 인크. | ANTI-cMet ANTIBODY DRUG CONJUGATES AND METHODS FOR THEIR USE |
CN109415441B (en) | 2016-05-24 | 2023-04-07 | 英斯梅德股份有限公司 | Antibodies and methods of making same |
JP2019523221A (en) | 2016-05-27 | 2019-08-22 | アッヴィ・バイオセラピューティクス・インコーポレイテッド | Anti-CD40 antibodies and uses thereof |
US10875921B2 (en) | 2016-05-27 | 2020-12-29 | Abbvie Biotherapeutics Inc. | Anti-4-1BB antibodies and their uses |
MX2018014387A (en) | 2016-05-27 | 2019-03-14 | Agenus Inc | Anti-tim-3 antibodies and methods of use thereof. |
MY194619A (en) | 2016-06-02 | 2022-12-07 | Abbvie Inc | Glucocorticoid receptor agonist and immunoconjugates thereof |
WO2017208210A1 (en) | 2016-06-03 | 2017-12-07 | Prothena Biosciences Limited | Anti-mcam antibodies and associated methods of use |
CN109311991B (en) | 2016-06-06 | 2022-08-30 | 希望之城 | BAFF-R targeting chimeric antigen receptor modified T cell and application thereof |
JP7275446B2 (en) | 2016-06-06 | 2023-05-18 | シティ・オブ・ホープ | BAFF-R antibody and uses thereof |
SG11201810697QA (en) | 2016-06-07 | 2018-12-28 | Max Delbrueck Centrum Fuer Molekulare Medizin Helmholtz Gemeinschaft | Chimeric antigen receptor and car-t cells that bind bcma |
WO2017214335A1 (en) | 2016-06-08 | 2017-12-14 | Abbvie Inc. | Anti-b7-h3 antibodies and antibody drug conjugates |
JP7237344B2 (en) | 2016-06-15 | 2023-03-13 | アイカーン スクール オブ メディシン アット マウント サイナイ | Influenza virus hemagglutinin protein and uses thereof |
WO2017216724A1 (en) | 2016-06-15 | 2017-12-21 | Novartis Ag | Methods for treating disease using inhibitors of bone morphogenetic protein 6 (bmp6) |
KR102512411B1 (en) | 2016-06-26 | 2023-03-22 | 젠노바 바이오파마슈티컬스 리미티드 | Antibody phage display library |
CA3028002A1 (en) | 2016-06-27 | 2018-01-04 | Juno Therapeutics, Inc. | Method of identifying peptide epitopes, molecules that bind such epitopes and related uses |
MA45493A (en) | 2016-06-27 | 2019-05-01 | Aicuris Anti Infective Cures Gmbh | HCMC ENTRY INHIBITORS. |
MA45491A (en) | 2016-06-27 | 2019-05-01 | Juno Therapeutics Inc | CMH-E RESTRICTED EPITOPES, BINDING MOLECULES AND RELATED METHODS AND USES |
US20190233533A1 (en) | 2016-06-28 | 2019-08-01 | Umc Utrecht Holding B.V. | Treatment Of IgE-Mediated Diseases With Antibodies That Specifically Bind CD38 |
WO2018007922A2 (en) | 2016-07-02 | 2018-01-11 | Prothena Biosciences Limited | Anti-transthyretin antibodies |
EP3478715A2 (en) | 2016-07-02 | 2019-05-08 | Prothena Biosciences Limited | Anti-transthyretin antibodies |
EP3478716A2 (en) | 2016-07-02 | 2019-05-08 | Prothena Biosciences Limited | Anti-transthyretin antibodies |
AU2017292172A1 (en) | 2016-07-06 | 2019-01-03 | Prothena Biosciences Limited | Assay for detecting total and S129 phosphorylated alpha-synuclein |
ES2948446T3 (en) | 2016-07-08 | 2023-09-12 | Sphingotec Gmbh | Adrenomedullin for the assessment of congestion in a subject with acute heart failure |
KR20190039937A (en) | 2016-07-08 | 2019-04-16 | 스태튼 바이오테크놀로지 비.브이. | Anti-ApoC3 antibodies and methods of use thereof |
BR112019000630A2 (en) | 2016-07-13 | 2019-07-09 | Biogen Ma Inc | lingo-1 antagonist dosage regimens and uses for treating demyelinating disorders |
JP7027401B2 (en) | 2016-07-14 | 2022-03-01 | ブリストル-マイヤーズ スクイブ カンパニー | Antibodies to TIM3 and its use |
JP7219376B2 (en) | 2016-07-15 | 2023-02-08 | ノバルティス アーゲー | Treatment and prevention of cytokine release syndrome using chimeric antigen receptors in combination with kinase inhibitors |
EP3487506A1 (en) | 2016-07-20 | 2019-05-29 | Hybrigenics SA | Combinations of inecalcitol with an anti-cd38 agent and their uses for treating cancer |
JP2019528251A (en) | 2016-07-20 | 2019-10-10 | エスティーキューブ,インコーポレイテッド | Methods of treating and treating cancer using a combination of antibodies that bind to glycosylated PD-L1 |
WO2018015573A2 (en) | 2016-07-22 | 2018-01-25 | Deutsches Zentrum Für Neurodegenerative Erkrankungen E.V. (Dzne) | Trem2 cleavage modulators and uses thereof |
KR102435801B1 (en) | 2016-07-22 | 2022-08-25 | 암젠 인크 | Methods for Purification of FC-Containing Proteins |
US20190330318A1 (en) | 2016-07-25 | 2019-10-31 | Biogen Ma Inc. | Anti-hspa5 (grp78) antibodies and uses thereof |
BR112019001693A2 (en) | 2016-07-29 | 2019-07-02 | Ct Hospitalier Universitaire Toulouse | antibodies targeting tumor-associated macrophages and their uses |
EP3490600A1 (en) | 2016-08-01 | 2019-06-05 | Xoma (Us) Llc | Parathyroid hormone receptor 1 (pth1r) antibodies and uses thereof |
US11858980B2 (en) | 2016-08-02 | 2024-01-02 | Visterra, Inc. | Engineered polypeptides and uses thereof |
WO2018026969A2 (en) | 2016-08-03 | 2018-02-08 | Achaogen, Inc. | Plazomicin antibodies and methods of use |
WO2018027042A1 (en) | 2016-08-03 | 2018-02-08 | Bio-Techne Corporation | Identification of vsig3/vista as a novel immune checkpoint and use thereof for immunotherapy |
CN109689090B (en) | 2016-08-05 | 2023-12-26 | 免疫医疗有限责任公司 | anti-O2 antibodies and uses thereof |
EP3497120A1 (en) | 2016-08-12 | 2019-06-19 | Janssen Biotech, Inc. | Engineered antibodies and other fc-domain containing molecules with enhanced agonism and effector functions |
CN109843916B (en) | 2016-08-12 | 2023-10-31 | 詹森生物科技公司 | Fc-engineered anti-TNFR superfamily member antibodies with enhanced agonistic activity and methods of use thereof |
CN109790201A (en) | 2016-08-12 | 2019-05-21 | 百时美施贵宝公司 | Method for purifying proteins |
WO2018044970A1 (en) | 2016-08-31 | 2018-03-08 | University Of Rochester | Human monoclonal antibodies to human endogenous retrovirus k envelope (herv-k) and uses thereof |
TW201825674A (en) | 2016-09-09 | 2018-07-16 | 美商艾斯合顧問有限公司 | Oncolytic virus expressing bispecific engager molecules |
HUE051700T2 (en) | 2016-09-14 | 2021-03-29 | Abbvie Biotherapeutics Inc | Anti-pd-1 antibodies |
JP2020501508A (en) | 2016-09-15 | 2020-01-23 | クアドルセプト バイオ リミテッド | Multimers, tetramers and octamers |
WO2018057955A1 (en) | 2016-09-23 | 2018-03-29 | Elstar Therapeutics, Inc. | Multispecific antibody molecules comprising lambda and kappa light chains |
CA3038679A1 (en) | 2016-09-28 | 2018-04-05 | Xoma (Us) Llc | Antibodies that bind interleukin-2 and uses thereof |
GB201616596D0 (en) | 2016-09-29 | 2016-11-16 | Nascient Limited | Epitope and antibodies |
WO2018060453A1 (en) | 2016-09-30 | 2018-04-05 | Vhsquared Limited | Compositions |
EP3519437B1 (en) | 2016-09-30 | 2021-09-08 | F. Hoffmann-La Roche AG | Bispecific antibodies against p95her2 |
EP3519824A1 (en) | 2016-10-03 | 2019-08-07 | Abbott Laboratories | Improved methods of assessing uch-l1 status in patient samples |
WO2018066626A1 (en) | 2016-10-07 | 2018-04-12 | 第一三共株式会社 | Therapy for drug-resistant cancer by administration of anti-her2 antibody/drug conjugate |
AR110676A1 (en) | 2016-10-07 | 2019-04-24 | Novartis Ag | TREATMENT OF CANCER USING CHEMERIC ANTIGENS RECEPTORS |
TW202246349A (en) | 2016-10-11 | 2022-12-01 | 美商艾吉納斯公司 | Anti-lag-3 antibodies and methods of use thereof |
WO2018071822A2 (en) | 2016-10-13 | 2018-04-19 | Massachusetts Institute Of Technology | Antibodies that bind zika virus envelope protein and uses thereof |
WO2018071576A1 (en) | 2016-10-14 | 2018-04-19 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Treatment of tumors by inhibition of cd300f |
EP3312290A1 (en) | 2016-10-18 | 2018-04-25 | Ipsen Biopharm Limited | Cellular vamp cleavage assay |
SG11201903063UA (en) | 2016-10-19 | 2019-05-30 | Medimmune Llc | Anti-o1 antibodies and uses thereof |
EP3532489A4 (en) | 2016-10-26 | 2020-07-08 | Cedars-Sinai Medical Center | Neutralizing anti-tl1a monoclonal antibodies |
US11249082B2 (en) | 2016-10-29 | 2022-02-15 | University Of Miami | Zika virus assay systems |
WO2018085359A1 (en) | 2016-11-02 | 2018-05-11 | Immunogen, Inc. | Combination treatment with antibody-drug conjugates and parp inhibitors |
WO2018083238A1 (en) | 2016-11-03 | 2018-05-11 | Roche Diagnostics Gmbh | Novel anti-py792-ddr1 antibodies |
US11779604B2 (en) | 2016-11-03 | 2023-10-10 | Kymab Limited | Antibodies, combinations comprising antibodies, biomarkers, uses and methods |
WO2018083237A1 (en) | 2016-11-03 | 2018-05-11 | Roche Diagnostics Operations Inc. | Novel anti-py520-ddr1 antibodies |
WO2018083235A1 (en) | 2016-11-03 | 2018-05-11 | Roche Diagnostics Gmbh | Novel anti-py513-ddr1 antibodies |
WO2018083240A1 (en) | 2016-11-03 | 2018-05-11 | Roche Diagnostics Gmbh | Novel anti-py796-ddr1 antibodies |
WO2018083538A1 (en) | 2016-11-07 | 2018-05-11 | Neuracle Scienc3 Co., Ltd. | Anti-family with sequence similarity 19, member a5 antibodies and method of use thereof |
NZ754407A (en) | 2016-11-09 | 2023-01-27 | Philogen Spa | Il2 and tnf mutant immunoconjugates |
US20180125920A1 (en) | 2016-11-09 | 2018-05-10 | The University Of British Columbia | Methods for preventing and treating A-beta oligomer-associated and/or -induced diseases and conditions |
CA3043528A1 (en) | 2016-11-14 | 2018-05-17 | Amgen Inc. | Bispecific or biparatopic antigen binding proteins and uses thereof |
CN109996809A (en) | 2016-11-14 | 2019-07-09 | 诺华股份有限公司 | Composition relevant to fusogenic protein MINION, method and therapeutical uses |
NZ752394A (en) | 2016-11-14 | 2021-07-30 | Hangzhou Dac Biotech Co Ltd | Conjugation linkers, cell binding molecule-drug conjugates containing the likers, methods of making and uses such conjugates with the linkers |
AU2017362222A1 (en) | 2016-11-16 | 2019-05-30 | Janssen Biotech, Inc. | Method of treating psoriasis with anti-IL-23 specific antibody |
EP3541847A4 (en) | 2016-11-17 | 2020-07-08 | Seattle Genetics, Inc. | Glycan-interacting compounds and methods of use |
AU2017361887B2 (en) | 2016-11-21 | 2019-08-15 | Cureab Gmbh | Anti-GP73 antibodies and immunoconjugates |
WO2018098370A1 (en) | 2016-11-23 | 2018-05-31 | Immunoah Therapeutics, Inc. | 4-1bb binding proteins and uses thereof |
JP7227146B2 (en) | 2016-11-23 | 2023-02-21 | バイオベラティブ セラピューティクス インコーポレイテッド | A bispecific antibody that binds to coagulation factor IX and coagulation factor X |
JPWO2018097308A1 (en) | 2016-11-28 | 2019-10-17 | 中外製薬株式会社 | Ligand binding molecule with adjustable ligand binding activity |
CA3046082A1 (en) | 2016-12-07 | 2018-06-14 | Agenus Inc. | Antibodies and methods of use thereof |
MX2019006340A (en) | 2016-12-07 | 2019-11-07 | Agenus Inc | Anti-ctla-4 antibodies and methods of use thereof. |
KR20210157471A (en) | 2016-12-15 | 2021-12-28 | 애브비 바이오테라퓨틱스 인크. | Anti-ox40 antibodies and their uses |
EP3339324A1 (en) | 2016-12-22 | 2018-06-27 | sphingotec GmbH | Anti-adrenomedullin (adm) antibody or anti-adm antibody fragment or anti-adm non-ig scaffold for use in intervention and therapy of congestion in a patient in need thereof |
CN110167962A (en) | 2016-12-16 | 2019-08-23 | 艾德里诺医药公司 | For intervening and treating congested anti-adrenomedulin (ADM) antibody or anti-ADM antibody fragment or the non-Ig bracket of anti-ADM of the patient of needs |
GB201621635D0 (en) | 2016-12-19 | 2017-02-01 | Ucb Biopharma Sprl | Crystal structure |
CN110087682B (en) | 2016-12-19 | 2023-12-15 | 豪夫迈·罗氏有限公司 | Combination therapy with targeted 4-1BB (CD 137) agonists |
EP3559034B1 (en) | 2016-12-20 | 2020-12-02 | H. Hoffnabb-La Roche Ag | Combination therapy of anti-cd20/anti-cd3 bispecific antibodies and 4-1bb (cd137) agonists |
JP7202185B2 (en) | 2016-12-22 | 2023-01-11 | 第一三共株式会社 | Anti-CD3 antibodies and molecules comprising said antibodies |
RU2019123063A (en) | 2016-12-23 | 2021-01-26 | Вистерра, Инк. | BINDING POLYPEPTIDES AND METHODS FOR THEIR PREPARATION |
MX2019007642A (en) | 2016-12-23 | 2019-09-09 | Cephalon Inc | Anti-il-5 antibodies. |
FI3565592T3 (en) | 2017-01-06 | 2023-05-10 | Scholar Rock Inc | Treating metabolic diseases by inhibiting myostatin activation |
WO2018129395A1 (en) | 2017-01-06 | 2018-07-12 | Scholar Rock, Inc. | Methods for treating metabolic diseases by inhibiting myostatin activation |
WO2018129329A1 (en) | 2017-01-06 | 2018-07-12 | Scholar Rock, Inc. | ISOFORM-SPECIFIC, CONTEXT-PERMISSIVE TGFβ1 INHIBITORS AND USE THEREOF |
EP3565845A4 (en) | 2017-01-06 | 2020-10-07 | Biosion, Inc. | Erbb2 antibodies and uses therefore |
US20180244785A1 (en) | 2017-01-09 | 2018-08-30 | Merrimack Pharmaceuticals, Inc. | Anti-fgfr antibodies and methods of use |
WO2018130661A1 (en) | 2017-01-13 | 2018-07-19 | Academia Sinica | Reloadable hydrogel system for treating brain conditions |
TWI659750B (en) | 2017-01-13 | 2019-05-21 | 中央研究院 | Improved reloadable hydrogel system for treating myocardial infarction |
MX2019008059A (en) | 2017-01-17 | 2019-12-11 | Daiichi Sankyo Co Ltd | Anti-gpr20 antibody and anti-gpr20 antibody-drug conjugate. |
AU2018209940A1 (en) | 2017-01-18 | 2019-07-11 | Visterra, Inc. | Antibody molecule-drug conjugates and uses thereof |
WO2018137705A1 (en) | 2017-01-26 | 2018-08-02 | Zai Lab (Shanghai) Co., Ltd. | Cd47 antigen binding unit and uses thereof |
EP3574012A1 (en) | 2017-01-27 | 2019-12-04 | Memorial Sloan Kettering Cancer Center | Bispecific her2 and cd3 binding molecules |
CA3052095A1 (en) | 2017-01-30 | 2018-08-02 | Janssen Biotech, Inc. | Anti-tnf antibodies, compositions, and methods for the treatment of active psoriatic arthritis |
US10240205B2 (en) | 2017-02-03 | 2019-03-26 | Population Bio, Inc. | Methods for assessing risk of developing a viral disease using a genetic test |
US11623945B2 (en) | 2017-02-06 | 2023-04-11 | The United States Of America, As Represented By The Secretary Of Agriculture | Immunostimulating compositions and uses therefore |
SG10201912368XA (en) | 2017-02-07 | 2020-02-27 | Daiichi Sankyo Co Ltd | Anti-gprc5d antibody and molecule comprising the antibody |
MA47442A (en) | 2017-02-07 | 2019-12-18 | Janssen Biotech Inc | ANTI-TNF ANTIBODIES, COMPOSITIONS AND METHODS FOR THE TREATMENT OF ACTIVE ANKYLOSING SPONDYLARTHRITIS |
CA3052911A1 (en) | 2017-02-08 | 2018-08-16 | Novartis Ag | Fgf21 mimetic antibodies and uses thereof |
US20200291089A1 (en) | 2017-02-16 | 2020-09-17 | Elstar Therapeutics, Inc. | Multifunctional molecules comprising a trimeric ligand and uses thereof |
EP3583124A1 (en) | 2017-02-17 | 2019-12-25 | Bristol-Myers Squibb Company | Antibodies to alpha-synuclein and uses thereof |
JP7106560B2 (en) | 2017-02-28 | 2022-07-26 | イミュノジェン・インコーポレーテッド | Maytansinoid derivatives with self-immolative peptide linkers and their conjugates |
WO2018158719A1 (en) | 2017-03-02 | 2018-09-07 | Novartis Ag | Engineered heterodimeric proteins |
WO2018158398A1 (en) | 2017-03-02 | 2018-09-07 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Antibodies having specificity to nectin-4 and uses thereof |
US10857230B2 (en) | 2017-03-03 | 2020-12-08 | Janssen Biotech, Inc. | Co-therapy comprising a small molecule CSF-1R inhibitor and an agonistic antibody that specifically binds CD40 for the treatment of cancer |
MA47812A (en) | 2017-03-03 | 2021-04-14 | Seagen Inc | COMPOUNDS INTERACTING WITH GLYCAN AND METHODS OF USE |
JOP20180021A1 (en) | 2017-03-16 | 2019-01-30 | Janssen Biotech Inc | Anti-phf-tau antibodies and uses thereof |
US11016092B2 (en) | 2017-03-23 | 2021-05-25 | Abbott Laboratories | Methods for aiding in the diagnosis and determination of the extent of traumatic brain injury in a human subject using the early biomarker ubiquitin carboxy-terminal hydrolase L1 |
CN110475790A (en) | 2017-03-24 | 2019-11-19 | 全药工业株式会社 | Anti- IgM/B cell surface antigen bispecific antibody |
AU2018240117A1 (en) | 2017-03-24 | 2019-09-19 | Beth Israel Deaconess Medical Center, Inc. | Methods for preventing and treating heart disease |
WO2018176019A1 (en) | 2017-03-24 | 2018-09-27 | The Regents Of The University Of California | Proteoglycan irregularities in abnormal fibroblasts and therapies based therefrom |
CN110382542B (en) | 2017-03-29 | 2023-06-09 | 豪夫迈·罗氏有限公司 | Bispecific antigen binding molecules to costimulatory TNF receptors |
WO2018178074A1 (en) | 2017-03-29 | 2018-10-04 | F. Hoffmann-La Roche Ag | Trimeric antigen binding molecules specific for a costimulatory tnf receptor |
CN110573528B (en) | 2017-03-29 | 2023-06-09 | 豪夫迈·罗氏有限公司 | Bispecific antigen binding molecules to costimulatory TNF receptors |
JP7229169B2 (en) | 2017-03-30 | 2023-02-27 | ザ・ジョンズ・ホプキンス・ユニバーシティ | A supramolecular high-affinity protein binding system for the purification of biomacromolecules |
WO2018184965A1 (en) | 2017-04-03 | 2018-10-11 | F. Hoffmann-La Roche Ag | Immunoconjugates of il-2 with an anti-pd-1 and tim-3 bispecific antibody |
LT3606946T (en) | 2017-04-03 | 2022-10-25 | F. Hoffmann-La Roche Ag | Immunoconjugates of an anti-pd-1 antibody with a mutant il-2 or with il-15 |
CN110914300A (en) | 2017-04-03 | 2020-03-24 | 安康乐济股份有限公司 | Methods of treating cancer using PS-targeted antibodies and immunooncology agents |
BR112019018767A2 (en) | 2017-04-03 | 2020-05-05 | Hoffmann La Roche | antibodies, bispecific antigen binding molecule, one or more isolated polynucleotides, one or more vectors, host cell, method for producing an antibody, pharmaceutical composition, uses, method for treating a disease in an individual and invention |
TWI788340B (en) | 2017-04-07 | 2023-01-01 | 美商必治妥美雅史谷比公司 | Anti-icos agonist antibodies and uses thereof |
CA3058652A1 (en) | 2017-04-07 | 2018-10-11 | Icahn School Of Medicine At Mount Sinai | Anti-influenza b virus neuraminidase antibodies and uses thereof |
EP3609915A1 (en) | 2017-04-12 | 2020-02-19 | Pfizer Inc | Antibodies having conditional affinity and methods of use thereof |
BR112019017241A2 (en) | 2017-04-13 | 2020-04-14 | Agenus Inc | anti-cd137 antibodies and methods of using them |
AU2018250695A1 (en) | 2017-04-14 | 2019-11-07 | Kodiak Sciences Inc. | Complement factor D antagonist antibodies and conjugates thereof |
US10877048B2 (en) | 2017-04-15 | 2020-12-29 | Abbott Laboratories | Methods for aiding in the hyperacute diagnosis and determination of traumatic brain injury in a human subject using early biomarkers |
JP2020517256A (en) | 2017-04-19 | 2020-06-18 | エルスター セラピューティクス, インコーポレイテッド | Multispecific molecules and uses thereof |
WO2018195243A1 (en) | 2017-04-20 | 2018-10-25 | Immunogen, Inc. | Cytotoxic benzodiazepine derivatives and conjugates thereof |
CN110506056A (en) | 2017-04-21 | 2019-11-26 | 斯塔滕生物技术有限公司 | Anti- APOC3 antibody and its application method |
CA3061206A1 (en) | 2017-04-22 | 2018-10-25 | Immunomic Therapeutics, Inc. | Improved lamp constructs |
EP4328241A2 (en) | 2017-04-28 | 2024-02-28 | Marengo Therapeutics, Inc. | Multispecific molecules comprising a non-immunoglobulin heterodimerization domain and uses thereof |
US10877038B2 (en) | 2017-04-28 | 2020-12-29 | Abbott Laboratories | Methods for aiding in the hyperacute diagnosis and determination of traumatic brain injury using early biomarkers on at least two samples from the same human subject |
EP3618863B1 (en) | 2017-05-01 | 2023-07-26 | Agenus Inc. | Anti-tigit antibodies and methods of use thereof |
JP7185884B2 (en) | 2017-05-02 | 2022-12-08 | 国立研究開発法人国立精神・神経医療研究センター | METHOD FOR PREDICTING AND DETERMINING THERAPEUTIC EFFECT OF IL-6 AND NEUTROPHIL-RELATED DISEASE |
IL270271B2 (en) | 2017-05-02 | 2023-03-01 | Immunomic Therapeutics Inc | Lamp (lysosomal associated membrane protein) constructs comprising cancer antigens |
CA3061516A1 (en) | 2017-05-02 | 2018-11-08 | Prothena Biosciences Limited | Antibodies recognizing tau |
US10865238B1 (en) | 2017-05-05 | 2020-12-15 | Duke University | Complement factor H antibodies |
JOP20190256A1 (en) | 2017-05-12 | 2019-10-28 | Icahn School Med Mount Sinai | Newcastle disease viruses and uses thereof |
TWI794230B (en) | 2017-05-15 | 2023-03-01 | 日商第一三共股份有限公司 | Anti cdh6 antibodies and anti cdh6 antibody drug conjugates, as well as manufacturing method thereof |
CA3063344A1 (en) | 2017-05-23 | 2018-11-29 | Helmholtz Zentrum Munchen - Deutsches Forschungszentrum Fur Gesundheit Und Umwelt (Gmbh) | Novel cd73 antibody, preparation and uses thereof |
AU2018272054A1 (en) | 2017-05-25 | 2019-09-26 | Abbott Laboratories | Methods for aiding in the determination of whether to perform imaging on a human subject who has sustained or may have sustained an injury to the head using early biomarkers |
JP7269183B2 (en) | 2017-05-30 | 2023-05-08 | アボット・ラボラトリーズ | Methods for Aiding in Diagnosing and Assessing Mild Traumatic Brain Injury in Human Subjects Using Cardiac Troponin I |
US20200166515A1 (en) | 2017-05-30 | 2020-05-28 | Nant Holdings Ip, Llc | Circulating tumor cell enrichment using neoepitopes |
EP3630835A1 (en) | 2017-05-31 | 2020-04-08 | STCube & Co., Inc. | Antibodies and molecules that immunospecifically bind to btn1a1 and the therapeutic uses thereof |
EP3630834A1 (en) | 2017-05-31 | 2020-04-08 | STCube & Co., Inc. | Methods of treating cancer using antibodies and molecules that immunospecifically bind to btn1a1 |
WO2018222901A1 (en) | 2017-05-31 | 2018-12-06 | Elstar Therapeutics, Inc. | Multispecific molecules that bind to myeloproliferative leukemia (mpl) protein and uses thereof |
WO2018224951A2 (en) | 2017-06-05 | 2018-12-13 | Janssen Biotech, Inc. | Engineered multispecific antibodies and other multimeric proteins with asymmetrical ch2-ch3 region mutations |
EP3634995A4 (en) | 2017-06-05 | 2021-06-09 | Janssen Biotech, Inc. | Antibodies that specifically bind pd-1 and methods of use |
CN110997724A (en) | 2017-06-06 | 2020-04-10 | 斯特库伯株式会社 | Methods of treating cancer using antibodies and molecules that bind BTN1A1 or BTN1A 1-ligands |
CN110997718B (en) | 2017-06-07 | 2023-11-10 | 菲洛根股份公司 | Vascular endothelial growth factor/anti-fibronectin antibody fusion proteins |
BR112019024291A2 (en) | 2017-06-09 | 2020-07-28 | Providence Health & Services-Oregon | use of cd39 and cd103 for the identification of reactive human tumor t cells for the treatment of cancer |
GB201709379D0 (en) | 2017-06-13 | 2017-07-26 | Univ Leuven Kath | Humanised ADAMTS13 binding antibodies |
WO2018229715A1 (en) | 2017-06-16 | 2018-12-20 | Novartis Ag | Compositions comprising anti-cd32b antibodies and methods of use thereof |
WO2018236904A1 (en) | 2017-06-19 | 2018-12-27 | Surface Oncology, Inc. | Combination of anti-cd47 antibodies and cell death-inducing agents, and uses thereof |
WO2018237173A1 (en) | 2017-06-22 | 2018-12-27 | Novartis Ag | Antibody molecules to cd73 and uses thereof |
EP3645042A4 (en) | 2017-06-26 | 2021-03-17 | Bio-Techne Corporation | Hybridoma clones, monoclonal antibodies to vsig-4, and methods of making and using |
WO2019006007A1 (en) | 2017-06-27 | 2019-01-03 | Novartis Ag | Dosage regimens for anti-tim-3 antibodies and uses thereof |
CN110785433A (en) | 2017-06-28 | 2020-02-11 | 诺华股份有限公司 | Method for preventing and treating urinary incontinence |
US20200115446A1 (en) | 2017-06-30 | 2020-04-16 | National University Corporation Hokkaido University | Pediatric osteoporosis drug that does not cause growth disorder |
WO2019010131A1 (en) | 2017-07-03 | 2019-01-10 | Abbott Laboratories | Improved methods for measuring ubiquitin carboxy-terminal hydrolase l1 levels in blood |
WO2019010164A1 (en) | 2017-07-06 | 2019-01-10 | President And Fellows Of Harvard College | Evolution of trna synthetases |
MX2020000342A (en) | 2017-07-11 | 2020-08-17 | Compass Therapeutics Llc | Agonist antibodies that bind human cd137 and uses thereof. |
GB201711208D0 (en) | 2017-07-12 | 2017-08-23 | Iontas Ltd | Ion channel inhibitors |
US20230331827A1 (en) | 2017-07-12 | 2023-10-19 | Maxion Therapeutics Limited | Potassium channel inhibitors |
KR20200027522A (en) | 2017-07-13 | 2020-03-12 | 에프. 호프만-라 로슈 아게 | New binders and assays for PIVKA |
SG11202000298VA (en) | 2017-07-14 | 2020-02-27 | Pfizer | Antibodies to madcam |
CA3070085A1 (en) | 2017-07-18 | 2019-01-24 | Promis Neurosciences Inc. | Antibodies to amyloid beta |
EP3431496A1 (en) | 2017-07-19 | 2019-01-23 | Fraunhofer-Gesellschaft zur Förderung der angewandten Forschung e.V. | Anti- isoasp7 amyloid beta antibodies and uses thereof |
JP2020527572A (en) | 2017-07-20 | 2020-09-10 | ノバルティス アーゲー | Anti-LAG-3 antibody dosage regimen and its use |
US11174322B2 (en) | 2017-07-24 | 2021-11-16 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Antibodies and peptides to treat HCMV related diseases |
SG11202000759XA (en) | 2017-07-27 | 2020-02-27 | Daiichi Sankyo Co Ltd | Anti-cd147 antibody |
EP3658583A1 (en) | 2017-07-28 | 2020-06-03 | Scholar Rock, Inc. | Ltbp complex-specific inhibitors of tgf-beta 1 and uses thereof |
JP6889328B2 (en) | 2017-07-31 | 2021-06-18 | エフ.ホフマン−ラ ロシュ アーゲーF. Hoffmann−La Roche Aktiengesellschaft | Humanization method based on three-dimensional structure |
CR20200099A (en) | 2017-08-03 | 2020-07-24 | Amgen Inc | Interleukin-21 muteins and methods of treatment |
WO2019030706A1 (en) | 2017-08-10 | 2019-02-14 | Janssen Pharmaceutica Nv | Anti-thrombin antibody molecules and methods for use in orthopedic surgery |
CN107446050A (en) | 2017-08-11 | 2017-12-08 | 百奥泰生物科技(广州)有限公司 | The compound and method of Trop2 positive diseases treatment |
WO2019035055A1 (en) | 2017-08-16 | 2019-02-21 | Janssen Pharmaceutica Nv | Anti-thrombin antibody molecules and methods for use with antiplatelet agents |
EP3444275A1 (en) | 2017-08-16 | 2019-02-20 | Exiris S.r.l. | Monoclonal antibody anti-fgfr4 |
WO2019035938A1 (en) | 2017-08-16 | 2019-02-21 | Elstar Therapeutics, Inc. | Multispecific molecules that bind to bcma and uses thereof |
EP3684811A2 (en) | 2017-08-17 | 2020-07-29 | Massachusetts Institute of Technology | Multiple specificity binders of cxc chemokines and uses thereof |
KR20200038303A (en) | 2017-08-18 | 2020-04-10 | 캠브리지 엔터프라이즈 리미티드 | Modular binding protein |
JP7379323B2 (en) | 2017-08-18 | 2023-11-14 | ザ・ジョンズ・ホプキンス・ユニバーシティ | Supramolecular filament assembly for protein purification |
CN111094349A (en) | 2017-08-23 | 2020-05-01 | 马克思-德布鲁克-分子医学中心亥姆霍兹联合会 | Chimeric antigen receptor and CAR-T cells binding CXCR5 |
CA3074317A1 (en) | 2017-08-25 | 2019-02-28 | Janssen Biotech, Inc. | Fc.gamma.rii binding fibronectin type iii domains, their conjugates and multispecific molecules comprising them |
WO2019040780A1 (en) | 2017-08-25 | 2019-02-28 | Five Prime Therapeutics Inc. | B7-h4 antibodies and methods of use thereof |
SG11202001499WA (en) | 2017-09-08 | 2020-03-30 | Amgen Inc | Inhibitors of kras g12c and methods of using the same |
US11464784B2 (en) | 2017-09-15 | 2022-10-11 | The Regents Of The University Of California | Inhibition of aminocylase 3 (AA3) in the treatment of cancer |
US11624130B2 (en) | 2017-09-18 | 2023-04-11 | President And Fellows Of Harvard College | Continuous evolution for stabilized proteins |
CN111108214B (en) | 2017-09-21 | 2023-10-13 | 贝克顿·迪金森公司 | Dangerous pollutant collecting kit and rapid test |
TW201922780A (en) | 2017-09-25 | 2019-06-16 | 美商健生生物科技公司 | Safe and effective method of treating Lupus with anti-IL12/IL23 antibody |
EP3854414A1 (en) | 2017-09-25 | 2021-07-28 | AdrenoMed AG | Anti-adrenomedullin (adm) binder for use in therapy or prevention of symptoms of illness |
CN111164208B (en) | 2017-09-29 | 2023-08-04 | 第一三共株式会社 | Antibody-pyrrolobenzodiazepine derivative conjugates |
WO2019070726A1 (en) | 2017-10-02 | 2019-04-11 | Visterra, Inc. | Antibody molecules to cd138 and uses thereof |
EP3461841B1 (en) | 2017-10-02 | 2019-09-11 | Certest Biotec, S.L. | Anti-dps antibodies and test devices for the detection of bacteria of the genus campylobacter |
CA3078460A1 (en) | 2017-10-04 | 2019-04-11 | Opko Pharmaceuticals, Llc | Articles and methods directed to personalized therapy of cancer |
JP7384668B2 (en) | 2017-10-05 | 2023-11-21 | 第一三共株式会社 | Composition for depleting cytotoxic T cells |
EP3693013A4 (en) | 2017-10-06 | 2021-06-30 | Ono Pharmaceutical Co., Ltd. | Bispecific antibody |
WO2019075090A1 (en) | 2017-10-10 | 2019-04-18 | Tilos Therapeutics, Inc. | Anti-lap antibodies and uses thereof |
US11707522B2 (en) | 2017-10-13 | 2023-07-25 | Boehringer Ingelheim International Gmbh | Human antibodies to Tn antigen |
WO2019077082A1 (en) | 2017-10-18 | 2019-04-25 | Adrenomed Ag | Therapy monitoring under treatment with an anti-adrenomedullin (adm) binder |
EP3697816A1 (en) | 2017-10-19 | 2020-08-26 | Debiopharm International S.A. | Combination product for the treatment of cancer |
KR20200074160A (en) | 2017-10-20 | 2020-06-24 | 가꼬우호우징 효고 이카다이가쿠 | Pharmaceutical composition for inhibiting post-surgical adhesion containing anti-IL-6 receptor antibody |
US20200331975A1 (en) | 2017-10-20 | 2020-10-22 | Institut Curie | Dap10/12 based cars adapted for rush |
WO2019081983A1 (en) | 2017-10-25 | 2019-05-02 | Novartis Ag | Antibodies targeting cd32b and methods of use thereof |
US11530276B2 (en) | 2017-10-25 | 2022-12-20 | 4TEEN4 Pharmaceuticals GmbH | DPP3 binder directed to and binding to specific DPP3-epitopes and its use in the prevention or treatment of diseases / acute conditions that are associated with oxidative stress |
WO2019089753A2 (en) | 2017-10-31 | 2019-05-09 | Compass Therapeutics Llc | Cd137 antibodies and pd-1 antagonists and uses thereof |
CA3080103A1 (en) | 2017-10-31 | 2019-05-09 | Staten Biotechnology B.V. | Anti-apoc3 antibodies and methods of use thereof |
KR20200079293A (en) | 2017-10-31 | 2020-07-02 | 얀센 바이오테크 인코포레이티드 | How to treat high-risk multiple myeloma |
WO2019089594A1 (en) | 2017-10-31 | 2019-05-09 | Immunogen, Inc. | Combination treatment with antibody-drug conjugates and cytarabine |
CA3079036A1 (en) | 2017-11-01 | 2019-05-09 | F. Hoffmann-La Roche Ag | Combination therapy with targeted ox40 agonists |
EP3703821A2 (en) | 2017-11-01 | 2020-09-09 | F. Hoffmann-La Roche AG | Bispecific 2+1 contorsbodies |
MX2020004561A (en) | 2017-11-02 | 2020-08-13 | Bayer Ag | Bispecific antibodies binding alk-1 and bmpr-2. |
WO2019094595A2 (en) | 2017-11-09 | 2019-05-16 | Pinteon Therapeutics Inc. | Methods and compositions for the generation and use of humanized conformation-specific phosphorylated tau antibodies |
JP2021503478A (en) | 2017-11-16 | 2021-02-12 | ノバルティス アーゲー | Combination treatment |
WO2019100052A2 (en) | 2017-11-20 | 2019-05-23 | Compass Therapeutics Llc | Cd137 antibodies and tumor antigen-targeting antibodies and uses thereof |
WO2019102435A1 (en) | 2017-11-27 | 2019-05-31 | Euro-Celtique S.A. | Humanized antibodies targeting human tissue factor |
TWI818934B (en) | 2017-11-28 | 2023-10-21 | 日商中外製藥股份有限公司 | Ligand-binding molecules with adjustable ligand-binding activity |
EP3717682A4 (en) | 2017-11-30 | 2021-09-01 | University of Delhi, South Campus | An antibody fragment library, and uses thereof |
WO2019113375A2 (en) | 2017-12-06 | 2019-06-13 | Magenta Therapeutics, Inc. | Dosing regimens for the mobilization of hematopoietic stem and progenitor cells |
WO2019113464A1 (en) | 2017-12-08 | 2019-06-13 | Elstar Therapeutics, Inc. | Multispecific molecules and uses thereof |
US11022617B2 (en) | 2017-12-09 | 2021-06-01 | Abbott Laboratories | Methods for aiding in the diagnosis and evaluation of a subject who has sustained an orthopedic injury and that has or may have sustained an injury to the head, such as mild traumatic brain injury (TBI), using glial fibrillary acidic protein (GFAP) and/or ubiquitin carboxy-terminal hydrolase L1 (UCH-L1) |
BR112020010085A2 (en) | 2017-12-09 | 2020-10-13 | Abbott Laboratories | methods to assist in the diagnosis and assessment of a traumatic brain injury in a human subject using a combination of gfap and uch-l1 |
EP3502139A1 (en) | 2017-12-19 | 2019-06-26 | Philogen S.p.A. | Antibodies to tumour antigens |
EP3502140A1 (en) | 2017-12-21 | 2019-06-26 | F. Hoffmann-La Roche AG | Combination therapy of tumor targeted icos agonists with t-cell bispecific molecules |
MX2020006119A (en) | 2017-12-21 | 2020-08-24 | Hoffmann La Roche | Antibodies binding to hla-a2/wt1. |
GB201721600D0 (en) | 2017-12-21 | 2018-02-07 | Plant Bioscience Ltd | Metabolic engineering |
WO2019131988A1 (en) | 2017-12-28 | 2019-07-04 | Chugai Seiyaku Kabushiki Kaisha | Cytotoxicity-inducing therapeutic agent |
WO2019133652A1 (en) | 2017-12-28 | 2019-07-04 | Immunogen, Inc. | Benzodiazepine derivatives |
EP3735422A1 (en) | 2018-01-05 | 2020-11-11 | AC Immune SA | Misfolded tdp-43 binding molecules |
JP7358361B2 (en) | 2018-01-12 | 2023-10-10 | ブリストル-マイヤーズ スクイブ カンパニー | Antibodies against TIM3 and their uses |
MX2020006976A (en) | 2018-01-12 | 2020-10-05 | Amgen Inc | Pac1 antibodies and uses thereof. |
CR20200330A (en) | 2018-01-12 | 2020-12-23 | Amgen Inc | Anti-pd-1 antibodies and methods of treatment |
US20190225689A1 (en) | 2018-01-22 | 2019-07-25 | Janssen Biotech, Inc. | Methods of treating cancers with antagonistic anti-pd-1 antibodies |
US20210363238A1 (en) | 2018-01-31 | 2021-11-25 | Motokazu Kato | Therapeutic agent for asthma containing il-6 inhibitor |
WO2019150309A1 (en) | 2018-02-02 | 2019-08-08 | Hammack Scott | Modulators of gpr68 and uses thereof for treating and preventing diseases |
CN111868082A (en) | 2018-02-02 | 2020-10-30 | 博奥泰克尼公司 | Compounds that modulate the interaction of VISTA and VSIG3 and methods of making and using the same |
SG11202006686SA (en) | 2018-02-08 | 2020-08-28 | Sphingotec Gmbh | Adrenomedullin (adm) for diagnosis and/or prediction of dementia and anti-adrenomedullin binder for use in therapy or prevention of dementia |
TWI804572B (en) | 2018-02-09 | 2023-06-11 | 日商小野藥品工業股份有限公司 | Bispecific antibody |
TWI829667B (en) | 2018-02-09 | 2024-01-21 | 瑞士商赫孚孟拉羅股份公司 | Antibodies binding to gprc5d |
CN111757894A (en) | 2018-02-14 | 2020-10-09 | Abba 疗法股份公司 | Anti-human PD-L2 antibody |
EP3752195A4 (en) | 2018-02-14 | 2021-11-17 | Viela Bio, Inc. | Antibodies to feline mcdonough sarcoma (fms)-like tyrosine kinase 3 receptor ligand (flt3l) and uses thereof for treating autoimmune and inflammatory diseases |
GB201802486D0 (en) | 2018-02-15 | 2018-04-04 | Ucb Biopharma Sprl | Methods |
EP3530282A1 (en) | 2018-02-27 | 2019-08-28 | Diaccurate | Therapeutic methods |
BR112020017925A2 (en) | 2018-03-02 | 2020-12-22 | Five Prime Therapeutics, Inc. | ANTIBODIES AGAINST B7-H4 AND METHODS OF USE OF THE SAME |
CN112105639A (en) | 2018-03-05 | 2020-12-18 | 詹森药业有限公司 | anti-PHF-tau antibodies and uses thereof |
JP2021515770A (en) | 2018-03-05 | 2021-06-24 | ヤンセン バイオテツク,インコーポレーテツド | Treatment of Crohn's disease using anti-IL-23 specific antibody |
US11859006B2 (en) | 2018-03-05 | 2024-01-02 | Saitama Medical University | Method of treating ectopic ossification or diffuse intrinsic pontine glioma in a subject by administering an anti-ALK2 antibody |
WO2019177690A1 (en) | 2018-03-12 | 2019-09-19 | Zoetis Services Llc | Anti-ngf antibodies and methods thereof |
WO2019175071A1 (en) | 2018-03-13 | 2019-09-19 | F. Hoffmann-La Roche Ag | Therapeutic combination of 4-1 bb agonists with anti-cd20 antibodies |
TW202003561A (en) | 2018-03-13 | 2020-01-16 | 瑞士商赫孚孟拉羅股份公司 | Combination therapy with targeted 4-1BB (CD137) agonists |
KR102411489B1 (en) | 2018-03-14 | 2022-06-23 | 서피스 온콜로지, 인크. | Antibodies that bind to CD39 and uses thereof |
EP3765517A1 (en) | 2018-03-14 | 2021-01-20 | Elstar Therapeutics, Inc. | Multifunctional molecules that bind to calreticulin and uses thereof |
EP3765497A1 (en) | 2018-03-14 | 2021-01-20 | F. Hoffmann-La Roche AG | Novel anti-troponint antibodies |
BR112020018235A2 (en) | 2018-03-14 | 2020-12-29 | F. Hoffmann-La Roche Ag | METHODS FOR GENERATING A POLYNUCLEOTIDE LIBRARY, POLYNUCLEOTIDE LIBRARIES, USE OF A LIBRARY, METHOD FOR GENERATING AN ANTIBODY LIBRARY AND METHOD OF SELECTING AN ANTIBODY |
US20210009711A1 (en) | 2018-03-14 | 2021-01-14 | Elstar Therapeutics, Inc. | Multifunctional molecules and uses thereof |
US11332524B2 (en) | 2018-03-22 | 2022-05-17 | Surface Oncology, Inc. | Anti-IL-27 antibodies and uses thereof |
TW202003565A (en) | 2018-03-23 | 2020-01-16 | 美商必治妥美雅史谷比公司 | Antibodies against MICA and/or MICB and uses thereof |
WO2019180272A1 (en) | 2018-03-23 | 2019-09-26 | Fundación Instituto De Investigación Sanitaria De Santiago De Compostela | Anti-leptin affinity reagents for use in the treatment of obesity and other leptin-resistance associated diseases |
HRP20230744T1 (en) | 2018-03-26 | 2023-10-27 | Glycanostics S.R.O. | Means and methods for glycoprofiling of a protein |
CN112313248A (en) | 2018-03-29 | 2021-02-02 | 百时美施贵宝公司 | Method for purifying monomeric monoclonal antibodies |
KR20200138254A (en) | 2018-03-30 | 2020-12-09 | 암젠 인크 | C-terminal antibody variant |
US11155618B2 (en) | 2018-04-02 | 2021-10-26 | Bristol-Myers Squibb Company | Anti-TREM-1 antibodies and uses thereof |
JP2021521273A (en) | 2018-04-12 | 2021-08-26 | メディアファーマ エス.アール.エル. | LGALS3BP antibody-drug conjugate and its use for cancer treatment |
WO2019200357A1 (en) | 2018-04-12 | 2019-10-17 | Surface Oncology, Inc. | Biomarker for cd47 targeting therapeutics and uses therefor |
US20210147547A1 (en) | 2018-04-13 | 2021-05-20 | Novartis Ag | Dosage Regimens For Anti-Pd-L1 Antibodies And Uses Thereof |
AR114284A1 (en) | 2018-04-13 | 2020-08-12 | Hoffmann La Roche | HER2 TARGETING ANTIGEN BINDING MOLECULES COMPOSING 4-1BBL |
WO2019201995A1 (en) | 2018-04-20 | 2019-10-24 | Medizinische Hochschule Hannover | Chimeric antigen receptor and car-t cells that bind a herpes virus antigen |
CN112585165A (en) | 2018-04-25 | 2021-03-30 | 普罗米修斯生物科学公司 | Optimized anti-TL 1A antibodies |
WO2019207159A1 (en) | 2018-04-27 | 2019-10-31 | Fondazione Ebri Rita Levi-Montalcini | Antibody directed against a tau-derived neurotoxic peptide and uses thereof |
KR20210005097A (en) | 2018-04-30 | 2021-01-13 | 메디뮨 리미티드 | Conjugates that target and remove aggregates |
WO2019222130A1 (en) | 2018-05-15 | 2019-11-21 | Immunogen, Inc. | Combination treatment with antibody-drug conjugates and flt3 inhibitors |
EP3793595A1 (en) | 2018-05-15 | 2021-03-24 | Immunomic Therapeutics, Inc. | Improved lamp constructs comprising allergens |
KR20210011002A (en) | 2018-05-16 | 2021-01-29 | 얀센 바이오테크 인코포레이티드 | Methods of treating cancer and methods of improving the efficacy of T-cell reinduction therapeutics |
EP3569614A1 (en) | 2018-05-18 | 2019-11-20 | Julius-Maximilians-Universität Würzburg | Compounds and methods for the immobilization of myostatin-inhibitors on the extracellular matrix by transglutaminase |
KR20210010996A (en) | 2018-05-21 | 2021-01-29 | 추가이 세이야쿠 가부시키가이샤 | Freeze-dried formulation enclosed in a glass container |
WO2019226617A1 (en) | 2018-05-21 | 2019-11-28 | Compass Therapeutics Llc | Compositions and methods for enhancing the killing of target cells by nk cells |
WO2019226658A1 (en) | 2018-05-21 | 2019-11-28 | Compass Therapeutics Llc | Multispecific antigen-binding compositions and methods of use |
JOP20200302A1 (en) | 2018-05-24 | 2020-11-23 | Janssen Biotech Inc | Anti-cd3 antibodies and uses thereof |
PE20210634A1 (en) | 2018-05-24 | 2021-03-23 | Janssen Biotech Inc | MONOSPECIFIC AND MULTISPECIFIC ANTI-TMEFF2 ANTIBODIES AND THEIR USES |
EP3802609A2 (en) | 2018-05-24 | 2021-04-14 | Janssen Biotech, Inc. | Psma binding agents and uses thereof |
GB201808617D0 (en) | 2018-05-25 | 2018-07-11 | Plant Bioscience Ltd | Scaffold modification |
TW202015726A (en) | 2018-05-30 | 2020-05-01 | 瑞士商諾華公司 | Entpd2 antibodies, combination therapies, and methods of using the antibodies and combination therapies |
US11830582B2 (en) | 2018-06-14 | 2023-11-28 | University Of Miami | Methods of designing novel antibody mimetics for use in detecting antigens and as therapeutic agents |
WO2019241649A1 (en) | 2018-06-14 | 2019-12-19 | President And Fellows Of Harvard College | Evolution of cytidine deaminases |
AU2019289176A1 (en) | 2018-06-18 | 2020-12-24 | Oxford University Innovation Limited | Gremlin-1 antagonist for the prevention and treatment of cancer |
KR20210035173A (en) | 2018-06-19 | 2021-03-31 | 아타르가, 엘엘씨 | Antibody molecule against complement component 5 and use thereof |
CN112533629A (en) | 2018-06-19 | 2021-03-19 | 阿尔莫生物科技股份有限公司 | Compositions and methods for combined use of IL-10 agents with chimeric antigen receptor cell therapy |
WO2019244107A1 (en) | 2018-06-21 | 2019-12-26 | Daiichi Sankyo Company, Limited | Compositions including cd3 antigen binding fragments and uses thereof |
EP3586865A1 (en) | 2018-06-21 | 2020-01-01 | Charité - Universitätsmedizin Berlin | Complement anaphylatoxin binders and their use in treatment of a subject having an ocular wound and/or fibrosis |
EA202190092A1 (en) | 2018-06-21 | 2021-05-18 | Юманити Терапьютикс, Инк. | COMPOSITIONS AND METHODS FOR TREATMENT AND PREVENTION OF NEUROLOGICAL DISORDERS |
WO2020003077A1 (en) | 2018-06-25 | 2020-01-02 | Janssen Pharmaceutica Nv | Anti-thrombin antibody molecules for use in patients at risk for gastrointestinal (gi) bleeding |
AU2019297451A1 (en) | 2018-07-03 | 2021-01-28 | Marengo Therapeutics, Inc. | Anti-TCR antibody molecules and uses thereof |
WO2020008083A1 (en) | 2018-07-05 | 2020-01-09 | Consejo Superior De Investigaciones Científicas | Therapeutic target in chemokine receptors for the screening of compounds useful for the treatment of pathological processes involving chemokine signaling |
PL3677278T3 (en) | 2018-07-11 | 2022-02-28 | Scholar Rock, Inc. | Isoform selective tgfbeta1 inhibitors and use thereof |
MX2021000347A (en) | 2018-07-11 | 2021-04-19 | Scholar Rock Inc | High-affinity, isoform-selective tgfî²1 inhibitors and use thereof. |
WO2020014473A1 (en) | 2018-07-11 | 2020-01-16 | Scholar Rock, Inc. | TGFβ1 INHIBITORS AND USE THEREOF |
WO2020016838A2 (en) | 2018-07-18 | 2020-01-23 | Janssen Biotech, Inc. | Sustained response predictors after treatment with anti-il23 specific antibody |
MA53158A (en) | 2018-07-20 | 2021-05-26 | Aicuris Gmbh & Co Kg | METHODS FOR SCREENING AND IDENTIFYING AGENTS INHIBITING OR MODULATING THE NUCLEAR EXIT COMPLEX OF THE HERPES VIRUS |
BR112021000934A2 (en) | 2018-07-20 | 2021-04-27 | Pierre Fabre Medicament | receiver for sight |
WO2020021465A1 (en) | 2018-07-25 | 2020-01-30 | Advanced Accelerator Applications (Italy) S.R.L. | Method of treatment of neuroendocrine tumors |
KR20210041586A (en) | 2018-08-01 | 2021-04-15 | 세파론, 인코포레이티드 | Anti-CXCR2 antibodies and uses thereof |
EP4177356A1 (en) | 2018-08-08 | 2023-05-10 | PML Screening, LLC | Methods for assessing risk of developing a viral disease using a genetic test |
WO2020033926A2 (en) | 2018-08-09 | 2020-02-13 | Compass Therapeutics Llc | Antibodies that bind cd277 and uses thereof |
WO2020033925A2 (en) | 2018-08-09 | 2020-02-13 | Compass Therapeutics Llc | Antibodies that bind cd277 and uses thereof |
US20210388089A1 (en) | 2018-08-09 | 2021-12-16 | Compass Therapeutics Llc | Antigen binding agents that bind cd277 and uses thereof |
US11548938B2 (en) | 2018-08-21 | 2023-01-10 | Quidel Corporation | DbpA antibodies and uses thereof |
US20220047701A1 (en) | 2018-09-10 | 2022-02-17 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Combination of her2/neu antibody with heme for treating cancer |
DK3883606T5 (en) | 2018-09-24 | 2024-01-02 | Janssen Biotech Inc | SAFE AND EFFECTIVE METHOD FOR TREATMENT OF ULCERATIVE COLITIS WITH ANTI-IL12/IL23 ANTIBODY |
AU2019346645A1 (en) | 2018-09-27 | 2021-04-29 | Marengo Therapeutics, Inc. | CSF1R/CCR2 multispecific antibodies |
AU2019349958A1 (en) | 2018-09-28 | 2021-05-06 | Kyowa Kirin Co., Ltd. | IL-36 antibodies and uses thereof |
CN112969503A (en) | 2018-10-03 | 2021-06-15 | 斯塔滕生物技术有限公司 | Antibodies specific for human and cynomolgus macaques APOC3 and methods of use thereof |
JP2022512595A (en) | 2018-10-05 | 2022-02-07 | バヴァリアン・ノルディック・アクティーゼルスカブ | Combination therapy to treat cancer by intravenous administration of recombinant MVA and immune checkpoint antagonists or immune checkpoint agonists |
JP2022504839A (en) | 2018-10-10 | 2022-01-13 | ティロス・セラピューティクス・インコーポレイテッド | Anti-LAP antibody mutants and their use |
UY38407A (en) | 2018-10-15 | 2020-05-29 | Novartis Ag | TREM2 STABILIZING ANTIBODIES |
MA53920A (en) | 2018-10-17 | 2021-09-15 | Janssen Biotech Inc | METHOD FOR PROVIDING SUBCUTANEOUS ADMINISTRATION OF ANTI-CD38 ANTIBODIES |
CA3115102A1 (en) | 2018-10-23 | 2020-04-30 | Regeneron Pharmaceuticals, Inc. | Anti-npr1 antibodies and uses thereof |
KR20210080465A (en) | 2018-10-23 | 2021-06-30 | 스칼러 락, 인크. | RGMc-selective inhibitors and uses thereof |
GB201817309D0 (en) | 2018-10-24 | 2018-12-05 | Ucb Biopharma Sprl | Antibodies |
GB201817311D0 (en) | 2018-10-24 | 2018-12-05 | Ucb Biopharma Sprl | Antibodies |
WO2020086408A1 (en) | 2018-10-26 | 2020-04-30 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | A high-yield perfusion-based transient gene expression bioprocess |
WO2020095104A1 (en) | 2018-11-05 | 2020-05-14 | Ludwig Institute For Cancer Research Ltd. | HUMANIZED AND VARIANT TGF-β3 SPECIFIC ANTIBODIES AND METHODS AND USES THEREOF |
CN113613725A (en) | 2018-11-05 | 2021-11-05 | 路德维格癌症研究所有限公司 | Humanized and variant TGF-beta 1 specific antibodies, methods and uses thereof |
AU2019379858B2 (en) | 2018-11-13 | 2024-01-04 | Janssen Biotech, Inc. | Control of trace metals during production of anti-CD38 antibodies |
MX2021005594A (en) | 2018-11-13 | 2021-10-22 | Compass Therapeutics Llc | Multispecific binding constructs against checkpoint molecules and uses thereof. |
TW202031298A (en) | 2018-11-14 | 2020-09-01 | 日商第一三共股份有限公司 | Anti-cdh6 antibody-pyrrolobenzodiazepine derivatives conjugate |
PE20211284A1 (en) | 2018-11-16 | 2021-07-19 | Bristol Myers Squibb Co | ANTI-NKG2A ANTIBODIES AND USES OF THEM |
WO2020104943A2 (en) | 2018-11-20 | 2020-05-28 | Janssen Biotech, Inc. | Safe and effective method of treating psoriasis with anti-il-23 specific antibody |
WO2020106358A1 (en) | 2018-11-20 | 2020-05-28 | Takeda Vaccines, Inc. | Novel anti-zika virus antibodies and uses thereof |
CA3119503A1 (en) | 2018-11-20 | 2020-05-28 | Bavarian Nordic A/S | Therapy for treating cancer with an intratumoral and/or intravenous administration of a recombinant mva encoding 4-1bbl (cd137l) and/or cd40l |
SG11202105163UA (en) | 2018-11-20 | 2021-06-29 | Perseus Proteomics Inc | Agent for inhibiting iron uptake into cells |
EP3886869A4 (en) | 2018-11-28 | 2022-07-06 | Forty Seven, Inc. | Genetically modified hspcs resistant to ablation regime |
US20200197517A1 (en) | 2018-12-18 | 2020-06-25 | Janssen Biotech, Inc. | Safe and Effective Method of Treating Lupus with Anti-IL12/IL23 Antibody |
JP2022514017A (en) | 2018-12-20 | 2022-02-09 | ノバルティス アーゲー | Combination of medicines |
WO2020128927A1 (en) | 2018-12-20 | 2020-06-25 | Kyowa Kirin Co., Ltd. | Fn14 antibodies and uses thereof |
AR117728A1 (en) | 2018-12-21 | 2021-08-25 | Hoffmann La Roche | CD28 ANTIGEN BINDING SUPERAGONIST MOLECULES WITH TUMOR TARGET |
MY198034A (en) | 2018-12-21 | 2023-07-27 | Hoffmann La Roche | Tumor-targeted agonistic cd28 antigen binding molecules |
US20220211798A1 (en) | 2018-12-21 | 2022-07-07 | 4TEEN4 Pharmaceuticals GmbH | Therapy guidance and/or therapy monitoring for a treatment with angiotensin-receptor-agonist and/or a precursor thereof |
CN113227135A (en) | 2018-12-28 | 2021-08-06 | 斯帕克斯治疗公司 | Binding molecules specific for claudin 18.2, compositions and methods thereof for the treatment of cancer and other diseases |
US20220119532A1 (en) | 2019-01-14 | 2022-04-21 | University Of Virginia Patent Foundation | Use of integrin inhibitors for treatment or prevention of a neurological immunity disorder and/or nervous system injury |
CN113474371A (en) | 2019-01-16 | 2021-10-01 | 指南针制药有限责任公司 | Formulations of antibodies that bind to human CD137 and uses thereof |
GB201900732D0 (en) | 2019-01-18 | 2019-03-06 | Ucb Biopharma Sprl | Antibodies |
CA3127236A1 (en) | 2019-01-22 | 2020-07-30 | Bristol-Myers Squibb Company | Antibodies against il-7r alpha subunit and uses thereof |
JPWO2020153467A1 (en) | 2019-01-24 | 2021-12-02 | 中外製薬株式会社 | New cancer antigens and antibodies against those antigens |
US11280801B2 (en) | 2019-01-28 | 2022-03-22 | Becton, Dickinson And Company | Hazardous contaminant collection device with integrated swab and test device |
JP2022524281A (en) | 2019-01-30 | 2022-05-02 | スカラー ロック インコーポレイテッド | LTBP complex-specific inhibitor of TGFβ and its use |
EP3918323A4 (en) | 2019-01-30 | 2022-12-28 | TrueBinding, Inc. | Anti-gal3 antibodies and uses thereof |
SG11202107720UA (en) | 2019-01-31 | 2021-08-30 | Agency Science Tech & Res | Cnx/erp57 inhibitor for use in the treatment or prevention of cancer |
US11738050B2 (en) | 2019-02-01 | 2023-08-29 | Regents Of The University Of Minnesota | Compounds binding to fibroblast activation protein alpha |
EP3693063A1 (en) | 2019-02-06 | 2020-08-12 | Diaccurate | Methods and compositions for treating cancer |
EP3696191A1 (en) | 2019-02-14 | 2020-08-19 | Fundación Instituto de Investigación contra la Leucemia Josep Carreras (IJC) | Car t-cells for the treatment of cd1a-positive cancer |
US10871640B2 (en) | 2019-02-15 | 2020-12-22 | Perkinelmer Cellular Technologies Germany Gmbh | Methods and systems for automated imaging of three-dimensional objects |
WO2020172571A1 (en) | 2019-02-21 | 2020-08-27 | Elstar Therapeutics, Inc. | Multifunctional molecules that bind to t cell related cancer cells and uses thereof |
AU2020226904A1 (en) | 2019-02-21 | 2021-09-16 | Marengo Therapeutics, Inc. | Anti-TCR antibody molecules and uses thereof |
WO2020169840A1 (en) | 2019-02-21 | 2020-08-27 | Cambridge Enterprise Limited | Bispecific proteins with a chimeric scaffold |
SG11202109056TA (en) | 2019-02-21 | 2021-09-29 | Marengo Therapeutics Inc | Multifunctional molecules that bind to calreticulin and uses thereof |
CN114127111A (en) | 2019-02-21 | 2022-03-01 | 马伦戈治疗公司 | Antibody molecules that bind NKP30 and uses thereof |
SG11202109033XA (en) | 2019-02-21 | 2021-09-29 | Marengo Therapeutics Inc | Multifunctional molecules that bind to t cells and uses thereof to treat autoimmune disorders |
GB201902392D0 (en) | 2019-02-21 | 2019-04-10 | Cambridge Entpr Ltd | Modular binding proteins |
MA55080A (en) | 2019-02-26 | 2022-01-05 | Inspirna Inc | HIGH AFFINITY ANTI-MERTK ANTIBODIES AND ASSOCIATED USES |
JOP20210233A1 (en) | 2019-02-26 | 2023-01-30 | Janssen Biotech Inc | Combination therapies and patient stratification with bispecific anti-egfr/c-met antibodies |
JPWO2020175689A1 (en) | 2019-02-28 | 2020-09-03 | ||
WO2020180819A1 (en) | 2019-03-03 | 2020-09-10 | Prothena Biosciences Limited | Antibodies recognizing tau |
JP2022525145A (en) | 2019-03-14 | 2022-05-11 | ヤンセン バイオテツク,インコーポレーテツド | A production method for producing an anti-IL12 / IL23 antibody composition. |
KR20210141583A (en) | 2019-03-18 | 2021-11-23 | 얀센 바이오테크 인코포레이티드 | Methods of Treating Psoriasis in Children Using Anti-IL-12/IL-23 Antibodies |
US20220153875A1 (en) | 2019-03-19 | 2022-05-19 | Chugai Seiyaku Kabushiki Kaisha | Antigen-binding molecule containing antigen-binding domain of which binding activity to antigen is changed depending on mta, and library for obtaining said antigen-binding domain |
GB201903767D0 (en) | 2019-03-19 | 2019-05-01 | Quadrucept Bio Ltd | Multimers, tetramers & octamers |
WO2020196474A1 (en) | 2019-03-25 | 2020-10-01 | 第一三共株式会社 | Antibody-pyrrolobenzodiazepine derivative conjugate |
EP3946435B1 (en) | 2019-03-25 | 2023-12-27 | Max-Delbrück-Centrum für Molekulare Medizin in der Helmholtz-Gemeinschaft | Enhancement of cytolytic t-cell activity by inhibiting ebag9 |
CA3191804A1 (en) | 2019-03-25 | 2020-10-01 | Daiichi Sankyo Company, Limited | Anti-her2 antibody-pyrrolobenzodiazepine derivative conjugate |
US20220177558A1 (en) | 2019-03-25 | 2022-06-09 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Treatment of taupathy disorders by targeting new tau species |
CN113811547A (en) | 2019-03-27 | 2021-12-17 | 国家医疗保健研究所 | Recombinant protein with CD40 activating properties |
TW202102226A (en) | 2019-03-27 | 2021-01-16 | 日商第一三共股份有限公司 | Combination of antibody-pyrrolobenzodiazepine derivative conjugate and PARP inhibitor |
WO2020198731A2 (en) | 2019-03-28 | 2020-10-01 | Danisco Us Inc | Engineered antibodies |
TW202102261A (en) | 2019-03-29 | 2021-01-16 | 美商艾特加有限責任公司 | Antibody molecules to fgf23 and uses thereof |
JP2022527493A (en) | 2019-03-29 | 2022-06-02 | ブリストル-マイヤーズ スクイブ カンパニー | How to measure the hydrophobicity of a chromatographic resin |
TW202102544A (en) | 2019-04-04 | 2021-01-16 | 日商小野藥品工業股份有限公司 | Bispecific antibody |
SG11202110986YA (en) | 2019-04-10 | 2021-11-29 | Chugai Pharmaceutical Co Ltd | Method for purifying fc region-modified antibody |
CN113677403A (en) | 2019-04-12 | 2021-11-19 | 豪夫迈·罗氏有限公司 | Bispecific antigen binding molecules comprising lipocalin muteins |
WO2020214690A1 (en) | 2019-04-15 | 2020-10-22 | Qwixel Therapeutics | Fusion protein composition(s) comprising targeted masked type i interferons (ifna and ifnb) and an antibody against tumor antigen, for use in the treatment of cancer |
US20220204608A1 (en) | 2019-04-17 | 2022-06-30 | Hiroshima University | Therapeutic agent for urological cancer which is characterized by being administered with il-6 inhibitor and ccr2 inhibitor in combination |
CN113747945A (en) | 2019-04-19 | 2021-12-03 | 詹森生物科技公司 | Methods of treating renal cancer with anti-PSMA/CD 3 antibodies |
CN113747944A (en) | 2019-04-19 | 2021-12-03 | 詹森生物科技公司 | Methods of treating prostate cancer with anti-PSMA/CD 3 antibodies |
MX2021012961A (en) | 2019-04-24 | 2021-11-25 | Heidelberg Pharma Res Gmbh | Amatoxin antibody-drug conjugates and uses thereof. |
JOP20210304A1 (en) | 2019-05-14 | 2023-01-30 | Janssen Biotech Inc | Combination therapies with bispecific anti-egfr/c-met antibodies and third generation egfr tyrosine kinase inhibitors |
US11850248B2 (en) | 2019-05-14 | 2023-12-26 | Yuhan Corporation | Therapies with 3rd generation EGFR tyrosine kinase inhibitors |
SG11202112453TA (en) | 2019-05-23 | 2021-12-30 | Ac Immune Sa | Anti-tdp-43 binding molecules and uses thereof |
JP2022534020A (en) | 2019-05-23 | 2022-07-27 | ヤンセン バイオテツク,インコーポレーテツド | Methods of treating inflammatory bowel disease with combination therapy of antibodies against IL-23 and TNF-alpha |
EP3976778A2 (en) | 2019-05-24 | 2022-04-06 | Instituto de Medicina Molecular João Lobo Antunes | Treatment of alt cancers |
SG11202112429PA (en) | 2019-05-29 | 2021-12-30 | Daiichi Sankyo Co Ltd | Dosage of an antibody-drug conjugate |
CN114174344A (en) | 2019-05-30 | 2022-03-11 | 美国安进公司 | Engineering hinge region to drive antibody dimerization |
EP4023230A4 (en) | 2019-06-05 | 2023-11-15 | Chugai Seiyaku Kabushiki Kaisha | Antibody cleavage site-binding molecule |
BR112021024938A2 (en) | 2019-06-12 | 2022-01-25 | Novartis Ag | Natriuretic peptide receptor 1 antibodies and methods of use |
GB201908431D0 (en) | 2019-06-12 | 2019-07-24 | Plant Bioscience Ltd | Biosynthetic genes and polypeptides |
WO2020257289A2 (en) | 2019-06-17 | 2020-12-24 | Visterra, Inc. | Humanized antibody molecules to cd138 and uses thereof |
CN114630675A (en) | 2019-06-18 | 2022-06-14 | 爱尔兰詹森科学公司 | Combination of Hepatitis B Virus (HBV) vaccine and anti-PD-1 or anti-PD-L1 antibody |
WO2020255009A2 (en) | 2019-06-18 | 2020-12-24 | Janssen Sciences Ireland Unlimited Company | Combination of hepatitis b virus (hbv) vaccines and anti-pd-1 antibody |
KR20220063148A (en) | 2019-06-21 | 2022-05-17 | 소리소 파마슈티컬스 인크. | composition |
EP3986571A1 (en) | 2019-06-21 | 2022-04-27 | Sorriso Pharmaceuticals, Inc. | Polypeptides |
CA3144566A1 (en) | 2019-06-21 | 2020-12-24 | Sorriso Pharmaceuticals, Inc. | Polypeptides |
GB201909104D0 (en) | 2019-06-25 | 2019-08-07 | Plant Bioscience Ltd | Transferase enzymes |
TW202115124A (en) | 2019-06-26 | 2021-04-16 | 瑞士商赫孚孟拉羅股份公司 | Novel antigen binding molecules binding to cea |
WO2020260326A1 (en) | 2019-06-27 | 2020-12-30 | F. Hoffmann-La Roche Ag | Novel icos antibodies and tumor-targeted antigen binding molecules comprising them |
CA3143524A1 (en) | 2019-06-28 | 2020-12-30 | Amgen Inc. | Anti-cgrp receptor/anti-pac1 receptor bispecific antigen binding proteins |
EP3994169A1 (en) | 2019-07-02 | 2022-05-11 | F. Hoffmann-La Roche AG | Immunoconjugates comprising a mutant interleukin-2 and an anti-cd8 antibody |
KR20220030956A (en) | 2019-07-05 | 2022-03-11 | 오노 야꾸힝 고교 가부시키가이샤 | Hematological cancer treatment by PD-1/CD3 bispecific protein |
JP2022542863A (en) | 2019-07-24 | 2022-10-07 | ハー・ルンドベック・アクチエゼルスカベット | Anti-mGluR5 antibody and uses thereof |
WO2021021606A1 (en) | 2019-07-26 | 2021-02-04 | Visterra, Inc. | Interleukin-2 agents and uses thereof |
JPWO2021020282A1 (en) | 2019-07-26 | 2021-02-04 | ||
JP6856183B1 (en) | 2019-07-30 | 2021-04-07 | 小野薬品工業株式会社 | Bispecific antibody |
GB201910899D0 (en) | 2019-07-31 | 2019-09-11 | Scancell Ltd | Binding members |
JP2022543553A (en) | 2019-07-31 | 2022-10-13 | エフ・ホフマン-ラ・ロシュ・アクチェンゲゼルシャフト | Antibody that binds to GPRC5D |
JP2022543551A (en) | 2019-07-31 | 2022-10-13 | エフ・ホフマン-ラ・ロシュ・アクチェンゲゼルシャフト | Antibody that binds to GPRC5D |
US20220267459A1 (en) | 2019-08-02 | 2022-08-25 | Fundacio Clinic Per A La Recerca Biomedica | Car t-cells against bcma for the treatment of multiple myeloma |
EP4031658A1 (en) | 2019-08-07 | 2022-07-27 | DB Biotech, AS | Improved horseradish peroxidase polypeptides |
WO2021025140A1 (en) | 2019-08-08 | 2021-02-11 | 小野薬品工業株式会社 | Dual-specific protein |
US20220242962A1 (en) | 2019-08-12 | 2022-08-04 | Aptevo Research And Development Llc | 4-1bb and ox40 binding proteins and related compositions and methods, antibodies against 4-1bb, antibodies against ox40 |
US11680098B2 (en) | 2019-08-30 | 2023-06-20 | Agenus Inc. | Antibodies that specifically bind human CD96 |
EP4021571A1 (en) | 2019-08-30 | 2022-07-06 | 4TEEN4 Pharmaceuticals GmbH | Therapy guidance and/or therapy monitoring for treatment of shock |
GB201912657D0 (en) | 2019-09-03 | 2019-10-16 | Scancell Ltd | Binding members |
EP4026560A4 (en) | 2019-09-04 | 2023-10-25 | Perseus Proteomics Inc. | Therapeutic agent for polycythemia |
EP4025303A1 (en) | 2019-09-04 | 2022-07-13 | Deutsches Zentrum für Neurodegenerative Erkrankungen e.V. (DZNE) | Herv inhibitors for use in treating tauopathies |
CA3150807A1 (en) | 2019-09-04 | 2021-03-11 | Y-Biologics Inc. | Anti-vsig4 antibody or antigen binding fragment and uses thereof |
GB201912882D0 (en) | 2019-09-06 | 2019-10-23 | Scancell Ltd | Ssea-4 binding members |
WO2021055329A1 (en) | 2019-09-16 | 2021-03-25 | Surface Oncology, Inc. | Anti-cd39 antibody compositions and methods |
JP2022548881A (en) | 2019-09-18 | 2022-11-22 | ノバルティス アーゲー | ENTPD2 Antibodies, Combination Therapy and Methods of Using Antibodies and Combination Therapy |
TW202124446A (en) | 2019-09-18 | 2021-07-01 | 瑞士商諾華公司 | Combination therapies with entpd2 antibodies |
AU2020353672A1 (en) | 2019-09-25 | 2022-03-31 | Surface Oncology, LLC | Anti-IL-27 antibodies and uses thereof |
JP2022549504A (en) | 2019-09-26 | 2022-11-25 | エスティーキューブ アンド カンパニー | Antibodies specific for glycosylated CTLA-4 and methods of use thereof |
WO2021059075A1 (en) | 2019-09-27 | 2021-04-01 | Janssen Biotech, Inc. | Anti-ceacam antibodies and uses thereof |
US20220324962A1 (en) | 2019-09-27 | 2022-10-13 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Anti-müllerian inhibiting substance antibodies and uses thereof |
WO2021058729A1 (en) | 2019-09-27 | 2021-04-01 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Anti-müllerian inhibiting substance type i receptor antibodies and uses thereof |
CA3154710A1 (en) | 2019-10-04 | 2021-04-08 | TAE Life Sciences | Antibody compositions comprising fc mutations and site-specific conjugation properties |
WO2021071830A1 (en) | 2019-10-07 | 2021-04-15 | University Of Virginia Patent Foundation | Modulating lymphatic vessels in neurological disease |
WO2021072277A1 (en) | 2019-10-09 | 2021-04-15 | Stcube & Co. | Antibodies specific to glycosylated lag3 and methods of use thereof |
CA3157509A1 (en) | 2019-10-10 | 2021-04-15 | Kodiak Sciences Inc. | Methods of treating an eye disorder |
WO2021077051A1 (en) | 2019-10-18 | 2021-04-22 | Immunomic Therapeutics, Inc | Improved lamp constructs comprising cancer antigens |
MX2022004769A (en) | 2019-10-21 | 2022-05-16 | Novartis Ag | Tim-3 inhibitors and uses thereof. |
CN114786679A (en) | 2019-10-21 | 2022-07-22 | 诺华股份有限公司 | Combination therapy with Vernetork and TIM-3 inhibitors |
CN114901311A (en) | 2019-10-24 | 2022-08-12 | 普罗米修斯生物科学公司 | Humanized antibodies to TNF-like ligand 1A (TL1A) and uses thereof |
US11459389B2 (en) | 2019-10-24 | 2022-10-04 | Massachusetts Institute Of Technology | Monoclonal antibodies that bind human CD161 |
EP4049675A4 (en) | 2019-10-25 | 2023-11-22 | Daiichi Sankyo Company, Limited | Combination of anti-garp antibody and immunoregulator |
EP4051298A1 (en) | 2019-11-01 | 2022-09-07 | Magenta Therapeutics, Inc. | Dosing regimens for the mobilization of hematopoietic stem and progentor cells |
WO2021092355A1 (en) | 2019-11-08 | 2021-05-14 | Amgen Inc. | Engineering charge pair mutations for pairing of hetero-igg molecules |
IL293051A (en) | 2019-11-18 | 2022-07-01 | Janssen Biotech Inc | Vaccines based on mutant calr and jak2 and their uses |
US20230047631A1 (en) | 2019-11-19 | 2023-02-16 | Amgen Inc. | Novel multispecific antibody format |
IL293009A (en) | 2019-11-20 | 2022-07-01 | Bavarian Nordic As | Recombinant mva viruses for intratumoral and/or intravenous administration for treating cancer |
CN114787181A (en) | 2019-11-21 | 2022-07-22 | Inserm(法国国家健康医学研究院) | Novel immunotherapy targeting PD-1 with anti-PD-1/IL-15 immunocytokines |
WO2021107082A1 (en) | 2019-11-27 | 2021-06-03 | 株式会社ペルセウスプロテオミクス | Therapeutic agent for carcinomatous peritonitis |
GB201917480D0 (en) | 2019-11-29 | 2020-01-15 | Univ Oxford Innovation Ltd | Antibodies |
WO2021116119A1 (en) | 2019-12-09 | 2021-06-17 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Antibodies having specificity to her4 and uses thereof |
JP2023507083A (en) | 2019-12-19 | 2023-02-21 | クイデル コーポレーション | monoclonal antibody fusion |
GB201919062D0 (en) | 2019-12-20 | 2020-02-05 | Ucb Biopharma Sprl | Antibody |
GB201919058D0 (en) | 2019-12-20 | 2020-02-05 | Ucb Biopharma Sprl | Multi-specific antibodies |
WO2021123996A1 (en) | 2019-12-20 | 2021-06-24 | Novartis Ag | Uses of anti-tgf-beta antibodies and checkpoint inhibitors for the treatment of proliferative diseases |
GB201919061D0 (en) | 2019-12-20 | 2020-02-05 | Ucb Biopharma Sprl | Multi-specific antibody |
TW202138388A (en) | 2019-12-30 | 2021-10-16 | 美商西根公司 | Methods of treating cancer with nonfucosylated anti-cd70 antibodies |
WO2021138407A2 (en) | 2020-01-03 | 2021-07-08 | Marengo Therapeutics, Inc. | Multifunctional molecules that bind to cd33 and uses thereof |
CA3160204A1 (en) | 2020-01-06 | 2021-07-15 | Vaccinex, Inc. | Anti-ccr8 antibodies and uses thereof |
US20230090552A1 (en) | 2020-01-08 | 2023-03-23 | Synthis Therapeutics, Inc. | Alk5 inhibitor conjugates and uses thereof |
KR20220139886A (en) | 2020-01-08 | 2022-10-17 | 리제너론 파아마슈티컬스, 인크. | Treatment of Progressive Osteogenic Fibrodysplasia |
CA3162009A1 (en) | 2020-01-09 | 2021-07-15 | F. Hoffmann-La Roche Ag | New 4-1bbl trimer-containing antigen binding molecules |
AU2021205440A1 (en) | 2020-01-11 | 2022-09-01 | Scholar Rock,Inc. | TGF-beta inhibitors and use thereof |
WO2021142427A1 (en) | 2020-01-11 | 2021-07-15 | Scholar Rock, Inc. | TGFβ INHIBITORS AND USE THEREOF |
TW202140553A (en) | 2020-01-13 | 2021-11-01 | 美商威特拉公司 | Antibody molecules to c5ar1 and uses thereof |
JP2023511274A (en) | 2020-01-14 | 2023-03-17 | シンセカイン インコーポレイテッド | IL2 orthologs and usage |
CN114980902A (en) | 2020-01-17 | 2022-08-30 | 诺华股份有限公司 | Combination comprising a TIM-3 inhibitor and a hypomethylated drug for the treatment of myelodysplastic syndrome or chronic myelomonocytic leukemia |
WO2021151079A1 (en) | 2020-01-24 | 2021-07-29 | University Of Virginia Patent Foundation | Modulating lymphatic vessels in neurological disease |
IL295129A (en) | 2020-01-30 | 2022-09-01 | Umoja Biopharma Inc | Bispecific transduction enhancer |
CA3167027A1 (en) | 2020-02-05 | 2021-08-12 | Larimar Therapeutics, Inc. | Tat peptide binding proteins and uses thereof |
TW202140012A (en) | 2020-02-12 | 2021-11-01 | 比利時商健生藥品公司 | Fgfr tyrosine kinase inhibitors and anti-pd1 agents for the treatment of urothelial carcinoma |
US20230096030A1 (en) | 2020-02-13 | 2023-03-30 | UCB Biopharma SRL | Bispecific antibodies against cd9 and cd7 |
EP4103611B1 (en) | 2020-02-13 | 2024-03-27 | UCB Biopharma SRL | Bispecific antibodies binding hvem and cd9 |
US20230125234A1 (en) | 2020-02-13 | 2023-04-27 | UCB Biopharma SRL | Anti cd44-ctla4 bispecific antibodies |
EP4103608A1 (en) | 2020-02-13 | 2022-12-21 | UCB Biopharma SRL | Bispecific antibodies against cd9 and cd137 |
US20230151109A1 (en) | 2020-02-13 | 2023-05-18 | UCB Biopharma SRL | Bispecific antibodies against cd9 |
TW202144388A (en) | 2020-02-14 | 2021-12-01 | 美商健生生物科技公司 | Neoantigens expressed in ovarian cancer and their uses |
TW202144389A (en) | 2020-02-14 | 2021-12-01 | 美商健生生物科技公司 | Neoantigens expressed in multiple myeloma and their uses |
WO2021167908A1 (en) | 2020-02-17 | 2021-08-26 | Board Of Regents, The University Of Texas System | Methods for expansion of tumor infiltrating lymphocytes and use thereof |
WO2021167964A1 (en) | 2020-02-18 | 2021-08-26 | Alector Llc | Pilra antibodies and methods of use thereof |
EP3871689A1 (en) | 2020-02-26 | 2021-09-01 | sphingotec GmbH | Anti-adm-antibodies binding to the free n-terminus for accelerated transition of adm-gly to bio-adm in patients with adm-gly/ bio-adm ratio above a threshold and combination with vitamin c |
MX2022010207A (en) | 2020-02-27 | 2022-11-16 | Adrenomed Ag | Anti-adrenomedullin (adm) antibody or anti-adm antibody fragment or anti-adm non-ig scaffold for use in therapy or prevention of shock. |
US20230193348A1 (en) | 2020-02-27 | 2023-06-22 | 4TEEN4 Pharmaceuticals GmbH | Dpp3 for therapy guidance, monitoring and stratification of nt-adm antibodies in patients with shock |
JP2023515985A (en) | 2020-02-27 | 2023-04-17 | アドレノメト アクチェンゲゼルシャフト | Anti-adrenomedullin (ADM) binding agent for use in treating patients in shock |
IL295979A (en) | 2020-03-06 | 2022-10-01 | Ona Therapeutics S L | Anti-cd36 antibodies and their use to treat cancer |
CN115315446A (en) | 2020-03-06 | 2022-11-08 | Go医疗股份有限公司 | anti-sugar-CD 44 antibodies and uses thereof |
IL296241A (en) | 2020-03-10 | 2022-11-01 | Massachusetts Inst Technology | Compositions and methods for immunotherapy of npm1c-positive cancer |
WO2021180890A1 (en) | 2020-03-11 | 2021-09-16 | Fundació Institut De Recerca Contra La Leucèmia Josep Carreras | Cd22 targeting-moiety for the treatment of b-cell acute lymphoblastic leukemia (b-all) |
EP3922993A1 (en) | 2020-06-12 | 2021-12-15 | 4TEEN4 Pharmaceuticals GmbH | Dpp3 in patients infected with coronavirus |
BR112022017890A2 (en) | 2020-03-16 | 2022-11-01 | Sphingotec Gmbh | PROADRENOMEDULLIN OR FRAGMENT OF THE SAME IN PATIENTS INFECTED WITH CORONAVIRUS AND TREATMENTS WITH LIGAND AGAINST ADRENOMEDULIN |
US20230213519A1 (en) | 2020-03-16 | 2023-07-06 | 4TEEN4 Pharmaceuticals GmbH | Dpp3 in patients infected with coronavirus |
WO2021190980A1 (en) | 2020-03-22 | 2021-09-30 | Quadrucept Bio Limited | Multimers for viral strain evolution |
US20230135752A1 (en) | 2020-03-27 | 2023-05-04 | PhotoQ3 Inc. | Medicament for killing tumor cells |
KR20220160598A (en) | 2020-03-30 | 2022-12-06 | 고쿠리츠다이가쿠호진 미에다이가쿠 | bispecific antibody |
US20230203191A1 (en) | 2020-03-30 | 2023-06-29 | Danisco Us Inc | Engineered antibodies |
EP4126064A1 (en) | 2020-04-03 | 2023-02-08 | Visterra, Inc. | Antibody molecule-drug conjugates and uses thereof |
US20230149555A1 (en) | 2020-04-06 | 2023-05-18 | PhotoQ3 Inc. | Medicament for killing tumor cells |
US20230295281A1 (en) | 2020-04-10 | 2023-09-21 | Vanudis GmbH | Natural antibodies in prophylaxis and therapy |
WO2021211331A1 (en) | 2020-04-13 | 2021-10-21 | Abbott Point Of Care Inc. | METHODS, COMPLEXES AND KITS FOR DETECTING OR DETERMINING AN AMOUNT OF A ß-CORONAVIRUS ANTIBODY IN A SAMPLE |
KR20230004494A (en) | 2020-04-15 | 2023-01-06 | 에프. 호프만-라 로슈 아게 | immunoconjugate |
JP2023523011A (en) | 2020-04-24 | 2023-06-01 | マレンゴ・セラピューティクス,インコーポレーテッド | Multifunctional molecules that bind to T cell-associated cancer cells and uses thereof |
EP4143302A1 (en) | 2020-04-27 | 2023-03-08 | Magenta Therapeutics, Inc. | Methods and compositions for transducing hematopoietic stem and progenitor cells in vivo |
CN115461363A (en) | 2020-05-01 | 2022-12-09 | 诺华股份有限公司 | Immunoglobulin variants |
EP4143236A1 (en) | 2020-05-01 | 2023-03-08 | Novartis AG | Engineered immunoglobulins |
CA3182697A1 (en) | 2020-05-11 | 2021-11-18 | Janssen Biotech, Inc. | Methods for treating multiple myeloma |
EP4149558A1 (en) | 2020-05-12 | 2023-03-22 | INSERM (Institut National de la Santé et de la Recherche Médicale) | New method to treat cutaneous t-cell lymphomas and tfh derived lymphomas |
US20230183366A1 (en) | 2020-05-13 | 2023-06-15 | Inserm (Institut National De La Santé Et De La Recherch Médicale) | Recombinant proteins with ox40 activating properties |
WO2021231732A1 (en) | 2020-05-15 | 2021-11-18 | Bristol-Myers Squibb Company | Antibodies to garp |
JP2023528235A (en) | 2020-05-17 | 2023-07-04 | アストラゼネカ・ユーケイ・リミテッド | SARS-CoV-2 Antibodies and Methods of Selecting and Using The Same |
KR20230013258A (en) | 2020-05-19 | 2023-01-26 | 얀센 바이오테크 인코포레이티드 | A composition comprising a T cell re-inducing therapeutic agent and a VLA-4 adhesion pathway inhibitor |
JP7352040B2 (en) | 2020-05-22 | 2023-09-27 | フィロジェン エッセ.ピー.アー. | TNFα immunoconjugate therapy for the treatment of brain tumors |
WO2021239666A1 (en) | 2020-05-26 | 2021-12-02 | Diaccurate | Therapeutic methods |
MX2022015157A (en) | 2020-06-02 | 2023-01-16 | Arcus Biosciences Inc | Antibodies to tigit. |
WO2021247908A1 (en) | 2020-06-03 | 2021-12-09 | Bionecure Therapeutics, Inc. | Trophoblast cell-surface antigen-2 (trop-2) antibodies |
TW202219065A (en) | 2020-06-19 | 2022-05-16 | 瑞士商赫孚孟拉羅股份公司 | Immune activating Fc domain binding molecules |
AR122659A1 (en) | 2020-06-19 | 2022-09-28 | Hoffmann La Roche | BISPECIFIC ANTIBODIES TO PROTEASE-ACTIVATED T-LYMPHOCYTES |
US20220017637A1 (en) | 2020-06-23 | 2022-01-20 | Hoffmann-La Roche Inc. | Agonistic cd28 antigen binding molecules targeting her2 |
WO2021261546A1 (en) | 2020-06-24 | 2021-12-30 | 国立大学法人 東京大学 | Photosensitizing dye |
EP4172206A1 (en) | 2020-06-24 | 2023-05-03 | Visterra, Inc. | Antibody molecules to april and uses thereof |
CN115916830A (en) | 2020-06-25 | 2023-04-04 | 豪夫迈·罗氏有限公司 | anti-CD 3/anti-CD 28 bispecific antigen binding molecules |
WO2022010797A2 (en) | 2020-07-07 | 2022-01-13 | Bionecure Therapeutics, Inc. | Novel maytansinoids as adc payloads and their use for the treatment of cancer |
TW202216761A (en) | 2020-07-16 | 2022-05-01 | 瑞士商諾華公司 | Anti-betacellulin antibodies, fragments thereof, and multi-specific binding molecules |
CN116507636A (en) | 2020-07-20 | 2023-07-28 | 阿斯利康(英国)有限公司 | SARS-CoV-2 proteins, anti-SARS-CoV-2 antibodies and methods of use thereof |
WO2022026592A2 (en) | 2020-07-28 | 2022-02-03 | Celltas Bio, Inc. | Antibody molecules to coronavirus and uses thereof |
BR112023000216A2 (en) | 2020-07-28 | 2023-02-07 | Chugai Pharmaceutical Co Ltd | PRE-FILLED SYRINGE PREPARATION WITH NEEDLE, WITH NEEDLE SHIELD AND INCLUDING MODIFIED ANTIBODY |
WO2022022662A1 (en) | 2020-07-31 | 2022-02-03 | 百奥泰生物制药股份有限公司 | Cd47 antibody and application thereof |
IL300225A (en) | 2020-07-31 | 2023-03-01 | Chugai Pharmaceutical Co Ltd | Pharmaceutical composition including cell expressing chimeric receptor |
US20220043000A1 (en) | 2020-08-04 | 2022-02-10 | Abbott Laboratories | Methods and kits for detecting sars-cov-2 protein in a sample |
EP4192511A1 (en) | 2020-08-07 | 2023-06-14 | Fortis Therapeutics, Inc. | Immunoconjugates targeting cd46 and methods of use thereof |
TW202221026A (en) | 2020-08-14 | 2022-06-01 | 瑞士商Ac 免疫有限公司 | Humanized anti-TDP-43 binding molecules and uses thereof |
CN116761821A (en) | 2020-08-18 | 2023-09-15 | 赛福伦有限责任公司 | anti-PAR-2 antibodies and methods of use thereof |
EP4200338A1 (en) | 2020-08-20 | 2023-06-28 | Amgen Inc. | Antigen binding proteins with non-canonical disulfide in fab region |
US20240009310A1 (en) | 2020-08-24 | 2024-01-11 | Charité - Universitätsmedizin Berlin | A CHIMERIC ANTIGEN RECEPTOR CONSTRUCT ENCODING A CHECKPOINT INHIBITORY MOLECULE AND AN IMMUNE STIMULATORY CYTOKINE AND CAR-EXPRESSING CELLS RECOGNIZING CD44v6 |
WO2022043312A1 (en) | 2020-08-24 | 2022-03-03 | Charité - Universitätsmedizin Berlin | Chimeric antigen receptor (car)-expressing cells recognizing cea |
CN116761818A (en) | 2020-08-26 | 2023-09-15 | 马伦戈治疗公司 | Method for detecting TRBC1 or TRBC2 |
CN116249718A (en) | 2020-08-26 | 2023-06-09 | 马伦戈治疗公司 | Multifunctional molecules binding to calreticulin and uses thereof |
GB2616128A (en) | 2020-08-26 | 2023-08-30 | Marengo Therapeutics Inc | Antibody molecules that bind to NKp30 and uses thereof |
EP4206224A1 (en) | 2020-08-26 | 2023-07-05 | National University Corporation Kumamoto University | Human antibody or antigen-binding fragment thereof against coronavirus spike protein |
CN116322763A (en) | 2020-08-27 | 2023-06-23 | 学校法人顺天堂 | Anti-cleavage mutant CALR-CD3 bispecific antibody and pharmaceutical composition |
EP4204448A2 (en) | 2020-08-27 | 2023-07-05 | cureab GmbH | Anti-golph2 antibodies for macrophage and dendritic cell differentiation |
WO2022043558A1 (en) | 2020-08-31 | 2022-03-03 | Advanced Accelerator Applications International Sa | Method of treating psma-expressing cancers |
WO2022043557A1 (en) | 2020-08-31 | 2022-03-03 | Advanced Accelerator Applications International Sa | Method of treating psma-expressing cancers |
EP4208197A1 (en) | 2020-09-04 | 2023-07-12 | Rutgers, The State University of New Jersey | Sars-cov-2 vaccines and antibodies |
BR112023004415A2 (en) | 2020-09-11 | 2023-05-09 | Medimmune Ltd | B7-H4 BINDING THERAPEUTIC MOLECULES |
EP4211663A2 (en) | 2020-09-12 | 2023-07-19 | MedImmune Limited | A scoring method for an anti-b7h4 antibody-drug conjugate therapy |
KR20230069958A (en) | 2020-09-14 | 2023-05-19 | 얀센 파마슈티카 엔.브이. | FGFR inhibitor combination therapy |
EP4213945A1 (en) | 2020-09-16 | 2023-07-26 | Janssen Biotech, Inc. | Methods for treating multiple myeloma |
US20230374162A1 (en) | 2020-10-07 | 2023-11-23 | Amgen Inc. | Rational selection of building blocks for the assembly of multispecific antibodies |
EP4227686A1 (en) | 2020-10-08 | 2023-08-16 | National University Corporation Tokai National Higher Education and Research System | Method for determining sensitivity or medicinal effect of anti-transferrin receptor antibody |
WO2022081718A1 (en) | 2020-10-14 | 2022-04-21 | Five Prime Therapeutics, Inc. | Anti-c-c chemokine receptor 8 (ccr8) antibodies and methods of use thereof |
EP4229086A1 (en) | 2020-10-15 | 2023-08-23 | UCB Biopharma SRL | Binding molecules that multimerise cd45 |
EP4229081A1 (en) | 2020-10-15 | 2023-08-23 | The United States of America, as represented by The Secretary, Department of Health and Human Services | Antibody specific for sars-cov-2 receptor binding domain and therapeutic methods |
EP4232475A1 (en) | 2020-10-20 | 2023-08-30 | Kantonsspital St. Gallen | Antibodies or antigen-binding fragments specifically binding to gremlin-1 and uses thereof |
WO2022087274A1 (en) | 2020-10-21 | 2022-04-28 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Antibodies that neutralize type-i interferon (ifn) activity |
EP4240765A2 (en) | 2020-11-06 | 2023-09-13 | Novartis AG | Antibody fc variants |
EP4244246A1 (en) | 2020-11-10 | 2023-09-20 | Amgen Inc. | Novel linkers of multispecific antigen binding domains |
EP4253415A1 (en) | 2020-11-12 | 2023-10-04 | Mabwell (Shanghai) Bioscience Co., Ltd. | Antibody and preparation method therefor |
WO2022115538A1 (en) | 2020-11-24 | 2022-06-02 | Bio-Techne Corporation | Anti-severe acute respiratory syndrome coronavirus antibodies |
MX2023006426A (en) | 2020-12-01 | 2023-07-17 | Aptevo Res And Development Llc | Heterodimeric psma and cd3-binding bispecific antibodies. |
WO2023102384A1 (en) | 2021-11-30 | 2023-06-08 | Abbott Laboratories | Use of one or more biomarkers to determine traumatic brain injury (tbi) in a subject having received a head computerized tomography scan that is negative for a tbi |
CA3198161A1 (en) | 2020-12-01 | 2022-06-09 | Beth MCQUISTON | Use of one or more biomarkers to determine traumatic brain injury (tbi) in a subject having received a head computerized tomography scan that is negative for a tbi |
EP4023218A1 (en) | 2020-12-02 | 2022-07-06 | S-Form Pharma | Combination therapy for patients having acute and/or persistent dyspnea |
WO2022120224A1 (en) | 2020-12-04 | 2022-06-09 | Visterra, Inc. | Methods of using interleukin-2 agents |
CN116635403A (en) | 2020-12-04 | 2023-08-22 | 豪夫迈·罗氏有限公司 | PH-dependent mutant interleukin-2 polypeptides |
WO2022130182A1 (en) | 2020-12-14 | 2022-06-23 | Novartis Ag | Reversal binding agents for anti-natriuretic peptide receptor 1 (npr1) antibodies and uses thereof |
US20220281914A1 (en) | 2020-12-18 | 2022-09-08 | Kiniksa Pharmaceuticals, Ltd. | Protein compositions and methods for producing and using the same |
WO2022147147A1 (en) | 2020-12-30 | 2022-07-07 | Abbott Laboratories | Methods for determining sars-cov-2 antigen and anti-sars-cov-2 antibody in a sample |
WO2022148853A1 (en) | 2021-01-11 | 2022-07-14 | F. Hoffmann-La Roche Ag | Immunoconjugates |
KR20230146521A (en) | 2021-01-13 | 2023-10-19 | 메모리얼 슬로안 케터링 캔서 센터 | Antibody-pyrrolobenzodiazepine derivative conjugate |
US20240115721A1 (en) | 2021-01-13 | 2024-04-11 | Memorial Sloan Kettering Cancer Center | Anti-dll3 antibody-drug conjugate |
KR20230147072A (en) | 2021-01-20 | 2023-10-20 | 비스테라, 인크. | Interleukin-2 mutants and uses thereof |
UY39610A (en) | 2021-01-20 | 2022-08-31 | Abbvie Inc | ANTI-EGFR ANTIBODY-DRUG CONJUGATES |
JP2024503908A (en) | 2021-01-22 | 2024-01-29 | バイエル アクチェンゲゼルシャフト | LRRC15 antibody and its conjugate |
BR112023015097A2 (en) | 2021-01-28 | 2023-10-03 | Janssen Biotech Inc | PSMA-BINDING PROTEINS AND USES THEREOF |
JP2024505049A (en) | 2021-01-29 | 2024-02-02 | ノバルティス アーゲー | Administration modes for anti-CD73 and anti-ENTPD2 antibodies and their uses |
US20220275090A1 (en) | 2021-02-22 | 2022-09-01 | Janssen Biotech, Inc. | Combination Therapies with Anti-CD38 Antibodies and PARP or Adenosine Receptor Inhibitors |
WO2022182872A2 (en) | 2021-02-24 | 2022-09-01 | Alladapt Immunotherapeutics, Inc. | Compositions and methods for identification of cross-reactive allergenic proteins and treatment of allergies |
US20220378929A1 (en) | 2021-02-25 | 2022-12-01 | MediBoston Limted | Anti-her2 antibody-drug conjugates and uses thereof |
WO2022184659A1 (en) | 2021-03-01 | 2022-09-09 | Quadrucept Bio Limited | Antibody domains & multimers |
US20240041978A1 (en) | 2021-03-03 | 2024-02-08 | The U.S.A., As Represented By The Secretary, Department Of Health And Human Services | La protein as a novel regulator of osteoclastogenesis |
WO2022184853A1 (en) | 2021-03-03 | 2022-09-09 | Pierre Fabre Medicament | Anti-vsig4 antibody or antigen binding fragment and uses thereof |
EP4301782A1 (en) | 2021-03-05 | 2024-01-10 | Go Therapeutics, Inc. | Anti-glyco-cd44 antibodies and their uses |
BR112023018278A2 (en) | 2021-03-09 | 2023-10-31 | Janssen Biotech Inc | TREATMENT OF CANCERS WITHOUT EGFR ACTIVATING MUTATIONS |
WO2022189380A1 (en) | 2021-03-09 | 2022-09-15 | F. Hoffmann-La Roche Ag | Combination therapy of pd-1-targeted il-2 variant immunoconjugate and anti-tyrp1/anti-cd3 bispecific antibodies |
BR112023018117A2 (en) | 2021-03-09 | 2023-10-31 | Hoffmann La Roche | IMMUNOCONJUGATES |
TW202302143A (en) | 2021-03-12 | 2023-01-16 | 日商中外製藥股份有限公司 | Pharmaceutical composition for treatment or prevention of myasthenia gravis |
EP4308694A1 (en) | 2021-03-16 | 2024-01-24 | Magenta Therapeutics, Inc. | Dosing regimens for hematopoietic stem cell mobilization for stem cell transplants in multiple myeloma patients |
CA3208011A1 (en) | 2021-03-17 | 2022-09-22 | Sarah Harris | Methods of treating atopic dermatitis with anti il-13 antibodies |
BR112023018331A2 (en) | 2021-03-18 | 2023-12-12 | Medimmune Ltd | THERAPEUTIC BINDING MOLECULE THAT BINDS TO CCR9 |
CN117321418A (en) | 2021-03-18 | 2023-12-29 | 诺华股份有限公司 | Cancer biomarkers and methods of use thereof |
KR20230141868A (en) | 2021-03-24 | 2023-10-10 | 와커 헤미 아게 | Method for producing organopolysiloxane with unsaturated groups |
WO2022204581A2 (en) | 2021-03-26 | 2022-09-29 | Scholar Rock, Inc. | Tgf-beta inhibitors and use thereof |
IL305818A (en) | 2021-03-29 | 2023-11-01 | Daiichi Sankyo Co Ltd | Stable multispecific molecule and use thereof |
CN117157312A (en) | 2021-03-30 | 2023-12-01 | 豪夫迈·罗氏有限公司 | Protease-activated polypeptides |
EP4067381A1 (en) | 2021-04-01 | 2022-10-05 | Julius-Maximilians-Universität Würzburg | Novel tnfr2 binding molecules |
TW202304979A (en) | 2021-04-07 | 2023-02-01 | 瑞士商諾華公司 | USES OF ANTI-TGFβ ANTIBODIES AND OTHER THERAPEUTIC AGENTS FOR THE TREATMENT OF PROLIFERATIVE DISEASES |
BR112023020832A2 (en) | 2021-04-08 | 2023-12-19 | Marengo Therapeutics Inc | TCR-BINDED MULTIFUNCTIONAL MOLECULES AND THEIR USES |
EP4326761A1 (en) | 2021-04-20 | 2024-02-28 | Amgen Inc. | Balanced charge distribution in electrostatic steering of chain pairing in multi-specific and monovalent igg molecule assembly |
TW202308689A (en) | 2021-04-21 | 2023-03-01 | 美商健生生物科技公司 | High concentration bispecific antibody formulations |
US20220372168A1 (en) | 2021-05-04 | 2022-11-24 | Regeneron Pharmaceuticals, Inc. | Multispecific fgf21 receptor agonists and their uses |
JP2024516970A (en) | 2021-05-07 | 2024-04-18 | サーフィス オンコロジー, エルエルシー | Anti-IL-27 antibodies and uses thereof |
TW202309522A (en) | 2021-05-11 | 2023-03-01 | 美商健生生物科技公司 | Methods and compositions for monitoring the treatment of relapsed and/or refractory multiple myeloma |
TW202309094A (en) | 2021-05-18 | 2023-03-01 | 美商健生生物科技公司 | Methods for identifying cancer patients for combination treatment |
AU2022279156A1 (en) | 2021-05-18 | 2023-11-02 | Abbott Laboratories | Methods of evaluating brain injury in a pediatric subject |
AU2022278013A1 (en) | 2021-05-18 | 2024-01-18 | Janssen Biotech, Inc. | Compositions comprising a t cell redirection therapeutic and an anti-cd44 therapeutic |
CN117412767A (en) | 2021-05-25 | 2024-01-16 | 雪绒花免疫公司 | C-X-C motif chemokine receptor 6 (CXCR 6) binding molecules and methods of use thereof |
EP4348263A1 (en) | 2021-05-28 | 2024-04-10 | Alexion Pharmaceuticals, Inc. | Methods for detecting cm-tma biomarkers |
AR126009A1 (en) | 2021-06-02 | 2023-08-30 | Hoffmann La Roche | CD28 ANTIGEN-BINDING AGONIST MOLECULES THAT TARGET EPCAM |
WO2022256723A2 (en) | 2021-06-03 | 2022-12-08 | Scholar Rock, Inc. | Tgf-beta inhibitors and therapeutic use thereof |
BR112023022097A2 (en) | 2021-06-07 | 2023-12-19 | Agonox Inc | CXCR5, PD-1 AND ICOS EXPRESSING TUMOR-REACTIVE CD4 T CELLS AND THEIR USE |
WO2022261183A2 (en) | 2021-06-08 | 2022-12-15 | Dana-Farber Cancer Institute, Inc. | Compositions and methods for treating and/or identifying an agent for treating intestinal cancers |
CA3222291A1 (en) | 2021-06-14 | 2022-12-22 | Jaime MARINO | Methods of diagnosing or aiding in diagnosis of brain injury caused by acoustic energy, electromagnetic energy, an over pressurization wave, and/or blast wind |
IL309349A (en) | 2021-06-14 | 2024-02-01 | argenx BV | Anti-il-9 antibodies and methods of use thereof |
IL308959A (en) | 2021-06-18 | 2024-01-01 | Nammi Therapeutics Inc | Fusion protein composition(s) comprising masked type i interferons (ifnα and ifnβ) for use in the treatment of cancer and methods thereof |
CA3221555A1 (en) | 2021-06-23 | 2022-12-29 | Kimberly LONG | A myostatin pathway inhibitor in combination with a glp-1 pathway activator for use in treating metabolic disorders |
IL309405A (en) | 2021-06-29 | 2024-02-01 | Seagen Inc | Methods of treating cancer with a combination of a nonfucosylated anti-cd70 antibody and a cd47 antagonist |
WO2023285878A1 (en) | 2021-07-13 | 2023-01-19 | Aviation-Ophthalmology | Methods for detecting, treating, and preventing gpr68-mediated ocular diseases, disorders, and conditions |
WO2023288267A1 (en) | 2021-07-14 | 2023-01-19 | 2Seventy Bio, Inc. | Engineered t cell receptors fused to binding domains from antibodies |
WO2023286854A1 (en) | 2021-07-16 | 2023-01-19 | ブライトパス・バイオ株式会社 | Anti-tim-3 antigen antibody or antibody derivative, and use thereof |
WO2023007472A1 (en) | 2021-07-30 | 2023-02-02 | ONA Therapeutics S.L. | Anti-cd36 antibodies and their use to treat cancer |
WO2023015170A2 (en) | 2021-08-02 | 2023-02-09 | Tavotek Biotech (Suzhou) Ltd | Anti-cd38 antibodies, anti-cd3 antibodies, and bispecific antibodies, and uses thereof |
WO2023015169A1 (en) | 2021-08-02 | 2023-02-09 | Tavotek Biotech (Suzhou) Ltd | Anti-cdh17 monoclonal and bispecific antibodies and uses thereof |
US11807685B2 (en) | 2021-08-05 | 2023-11-07 | The Uab Research Foundation | Anti-CD47 antibody and uses thereof |
WO2023014863A1 (en) | 2021-08-05 | 2023-02-09 | Go Therapeutics, Inc. | Anti-glyco-muc4 antibodies and their uses |
CA3228576A1 (en) | 2021-08-10 | 2023-02-16 | Byomass Inc. | Anti-gdf15 antibodies, compositions and uses thereof |
CN117836003A (en) | 2021-08-26 | 2024-04-05 | 株式会社英仙蛋白质科学 | ROS (reactive oxygen species) production enhancer |
AU2022335718A1 (en) | 2021-08-26 | 2024-03-28 | Glycanostics S.R.O | Glycoprotein biomarkers for diagnosing cancer |
CN117881784A (en) | 2021-08-31 | 2024-04-12 | 大正制药株式会社 | Anti-growth hormone antibodies |
WO2023034777A1 (en) | 2021-08-31 | 2023-03-09 | Abbott Laboratories | Methods and systems of diagnosing brain injury |
AR126971A1 (en) | 2021-09-03 | 2023-12-06 | Univ Of Bern | COMPOSITIONS AND METHODS FOR TREATING LONG QT SYNDROME |
TW202325733A (en) | 2021-09-03 | 2023-07-01 | 美商Go治療公司 | Anti-glyco-lamp1 antibodies and their uses |
CA3230934A1 (en) | 2021-09-03 | 2023-03-09 | Go Therapeutics, Inc. | Anti-glyco-cmet antibodies and their uses |
EP4144898A1 (en) | 2021-09-07 | 2023-03-08 | New/era/mabs GmbH | Method for selecting or screening antibodies from an antibody library |
AU2022346688A1 (en) | 2021-09-14 | 2024-04-04 | Glycanostics S.R.O | Use of lectins to determine mammaglobin-a glycoforms in breast cancer |
TW202320861A (en) | 2021-09-15 | 2023-06-01 | 日商第一三共股份有限公司 | Methods of treating chemotherapy-resistant cancer with an antibody-drug conjugate |
WO2023044483A2 (en) | 2021-09-20 | 2023-03-23 | Voyager Therapeutics, Inc. | Compositions and methods for the treatment of her2 positive cancer |
WO2023044094A1 (en) | 2021-09-20 | 2023-03-23 | Alnylam Pharmaceuticals, Inc. | Inhibin subunit beta e (inhbe) modulator compositions and methods of use thereof |
AU2022354059A1 (en) | 2021-09-30 | 2024-03-28 | Abbott Laboratories | Methods and systems of diagnosing brain injury |
WO2023057871A1 (en) | 2021-10-04 | 2023-04-13 | Novartis Ag | Surfactant stabilizers |
TW202333781A (en) | 2021-10-08 | 2023-09-01 | 日商中外製藥股份有限公司 | Anti-hla-dq2.5 antibody formulation |
WO2023062048A1 (en) | 2021-10-14 | 2023-04-20 | F. Hoffmann-La Roche Ag | Alternative pd1-il7v immunoconjugates for the treatment of cancer |
AU2022362681A1 (en) | 2021-10-14 | 2024-04-04 | F. Hoffmann-La Roche Ag | New interleukin-7 immunoconjugates |
CA3232216A1 (en) | 2021-10-18 | 2023-04-27 | Tavotek Biotherapeutics (Hong Kong) Limited | Anti-egfr antibodies, anti-cmet antibodies, anti-vegf antibodies, multispecific antibodies, and uses thereof |
WO2023069421A1 (en) | 2021-10-18 | 2023-04-27 | Byomass Inc. | Anti-activin a antibodies, compositions and uses thereof |
WO2023079494A1 (en) | 2021-11-03 | 2023-05-11 | Janssen Biotech, Inc. | Corticosteriod reduction in treatment with anti-cd38 antibodies |
EP4177266A1 (en) | 2021-11-05 | 2023-05-10 | Katholieke Universiteit Leuven | Neutralizing anti-sars-cov-2 human antibodies |
WO2023090361A1 (en) | 2021-11-16 | 2023-05-25 | 国立大学法人鳥取大学 | Mammalian artificial chromosomal vector having human immunoglobulin heavy chain locus containing modified d region, and cell or non-human animal holding said vector |
AR127692A1 (en) | 2021-11-16 | 2024-02-21 | Ac Immune Sa | ANTI-ASC ANTIBODIES FOR USE IN ANTI-INFLAMMATORY TREATMENTS |
WO2023092004A1 (en) | 2021-11-17 | 2023-05-25 | Voyager Therapeutics, Inc. | Compositions and methods for the treatment of tau-related disorders |
WO2023089377A2 (en) | 2021-11-19 | 2023-05-25 | Mirobio Limited | Engineered pd-1 antibodies and uses thereof |
US20230348614A1 (en) | 2021-11-24 | 2023-11-02 | Visterra, Inc. | Engineered antibody molecules to cd138 and uses thereof |
WO2023094569A1 (en) | 2021-11-26 | 2023-06-01 | F. Hoffmann-La Roche Ag | Combination therapy of anti-tyrp1/anti-cd3 bispecific antibodies and tyrp1-specific antibodies |
WO2023097119A2 (en) | 2021-11-29 | 2023-06-01 | Dana-Farber Cancer Institute, Inc. | Methods and compositions to modulate riok2 |
US20240041981A1 (en) | 2021-12-01 | 2024-02-08 | Visterra, Inc. | Methods of using interleukin-2 agents |
US20230183360A1 (en) | 2021-12-09 | 2023-06-15 | Janssen Biotech, Inc. | Use of Amivantamab to Treat Colorectal Cancer |
GB202117928D0 (en) | 2021-12-11 | 2022-01-26 | Cancer Research Tech Ltd | Immunotherapy for cancer |
WO2023114978A1 (en) | 2021-12-17 | 2023-06-22 | Abbott Laboratories | Systems and methods for determining uch-l1, gfap, and other biomarkers in blood samples |
WO2023122213A1 (en) | 2021-12-22 | 2023-06-29 | Byomass Inc. | Targeting gdf15-gfral pathway cross-reference to related applications |
WO2023118508A1 (en) | 2021-12-23 | 2023-06-29 | Bavarian Nordic A/S | Recombinant mva viruses for intraperitoneal administration for treating cancer |
WO2023129942A1 (en) | 2021-12-28 | 2023-07-06 | Abbott Laboratories | Use of biomarkers to determine sub-acute traumatic brain injury (tbi) in a subject having received a head computerized tomography (ct) scan that is negative for a tbi or no head ct scan |
US20230295348A1 (en) | 2022-01-24 | 2023-09-21 | Novimmune Sa | Composition and methods for the selective activation of cytokine signaling pathways |
WO2023147107A1 (en) | 2022-01-31 | 2023-08-03 | Byomass Inc. | Myeloproliferative conditions |
WO2023144303A1 (en) | 2022-01-31 | 2023-08-03 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Cd38 as a biomarker and biotarget in t-cell lymphomas |
WO2023150652A1 (en) | 2022-02-04 | 2023-08-10 | Abbott Laboratories | Lateral flow methods, assays, and devices for detecting the presence or measuring the amount of ubiquitin carboxy-terminal hydrolase l1 and/or glial fibrillary acidic protein in a sample |
WO2023150778A1 (en) | 2022-02-07 | 2023-08-10 | Visterra, Inc. | Anti-idiotype antibody molecules and uses thereof |
TW202342057A (en) | 2022-02-07 | 2023-11-01 | 美商健生生物科技公司 | Methods for reducing infusion-related reactions in patients treated with egfr/met bispecific antibodies |
WO2023154305A2 (en) | 2022-02-10 | 2023-08-17 | Amgen Inc. | Antibody protein product expression constructs for high throughput sequencing |
TW202342519A (en) | 2022-02-16 | 2023-11-01 | 瑞士商Ac 免疫有限公司 | Humanized anti-tdp-43 binding molecules and uses thereof |
WO2023166081A1 (en) | 2022-03-02 | 2023-09-07 | Heidelberg Immunotherapeutics Gmbh | Vaccine comprising an antibody or an fc-containing fusion protein comprising an fc part of an antibody |
US20240002544A1 (en) | 2022-03-07 | 2024-01-04 | Novimmune Sa | Cd28 bispecific antibodies for targeted t cell activation |
WO2023169896A1 (en) | 2022-03-09 | 2023-09-14 | Astrazeneca Ab | BINDING MOLECULES AGAINST FRα |
WO2023170216A1 (en) | 2022-03-11 | 2023-09-14 | Astrazeneca Ab | A SCORING METHOD FOR AN ANTI-FRα ANTIBODY-DRUG CONJUGATE THERAPY |
WO2023175035A1 (en) | 2022-03-15 | 2023-09-21 | Adrenomed Ag | Stable aqueous formulation of an anti-adrenomedullin (adm) antibody or anti-adm antibody fragment |
WO2023175171A1 (en) | 2022-03-18 | 2023-09-21 | Inserm (Institut National De La Sante Et De La Recherche Medicale) | Bk polyomavirus antibodies and uses thereof |
TW202402794A (en) | 2022-03-28 | 2024-01-16 | 瑞士商赫孚孟拉羅股份公司 | Improved folr1 protease-activatable t cell bispecific antibodies |
WO2023192436A1 (en) | 2022-03-31 | 2023-10-05 | Alexion Pharmaceuticals, Inc. | Singleplex or multiplexed assay for complement markers in fresh biological samples |
US20230416361A1 (en) | 2022-04-06 | 2023-12-28 | Mirobio Limited | Engineered cd200r antibodies and uses thereof |
WO2023194539A1 (en) | 2022-04-07 | 2023-10-12 | Heidelberg Pharma Research Gmbh | Methods of improving the therapeutic index of amatoxin-antibody conjugates |
GB202205203D0 (en) | 2022-04-08 | 2022-05-25 | UCB Biopharma SRL | Combination with inhibitor |
GB202205200D0 (en) | 2022-04-08 | 2022-05-25 | Ucb Biopharma Sprl | Combination with chemotherapy |
WO2023194565A1 (en) | 2022-04-08 | 2023-10-12 | Ac Immune Sa | Anti-tdp-43 binding molecules |
WO2023201201A1 (en) | 2022-04-10 | 2023-10-19 | Immunomic Therapeutics, Inc. | Bicistronic lamp constructs comprising immune response enhancing genes and methods of use thereof |
WO2023203177A1 (en) | 2022-04-20 | 2023-10-26 | Kantonsspital St. Gallen | Antibodies or antigen-binding fragments pan-specifically binding to gremlin-1 and gremlin-2 and uses thereof |
TW202400637A (en) | 2022-04-25 | 2024-01-01 | 美商威特拉公司 | Antibody molecules to april and uses thereof |
WO2023209568A1 (en) | 2022-04-26 | 2023-11-02 | Novartis Ag | Multispecific antibodies targeting il-13 and il-18 |
WO2023209177A1 (en) | 2022-04-29 | 2023-11-02 | Astrazeneca Uk Limited | Sars-cov-2 antibodies and methods of using the same |
WO2023215498A2 (en) | 2022-05-05 | 2023-11-09 | Modernatx, Inc. | Compositions and methods for cd28 antagonism |
WO2023220695A2 (en) | 2022-05-13 | 2023-11-16 | Voyager Therapeutics, Inc. | Compositions and methods for the treatment of her2 positive cancer |
WO2023228095A1 (en) | 2022-05-24 | 2023-11-30 | Daiichi Sankyo Company, Limited | Dosage regimen of an anti-cdh6 antibody-drug conjugate |
WO2023240124A1 (en) | 2022-06-07 | 2023-12-14 | Regeneron Pharmaceuticals, Inc. | Pseudotyped viral particles for targeting tcr-expressing cells |
WO2023245097A2 (en) | 2022-06-16 | 2023-12-21 | Cephalon Llc | Anti-pd-1 antibody-attenuated il-2 immunoconjugates and uses thereof |
EP4296279A1 (en) | 2022-06-23 | 2023-12-27 | Fraunhofer-Gesellschaft zur Förderung der angewandten Forschung e.V. | Anti-transthyretin (ttr) binding proteins and uses thereof |
GB202209501D0 (en) | 2022-06-29 | 2022-08-10 | Plant Bioscience Ltd | Biosynthetic enzymes |
WO2024006876A1 (en) | 2022-06-29 | 2024-01-04 | Abbott Laboratories | Magnetic point-of-care systems and assays for determining gfap in biological samples |
WO2024003837A1 (en) | 2022-06-30 | 2024-01-04 | Janssen Biotech, Inc. | Use of anti-egfr/anti-met antibody to treat gastric or esophageal cancer |
WO2024006961A1 (en) | 2022-07-01 | 2024-01-04 | Neoleukin Therapeutics, Inc. | Neo-2/15 variants and uses thereof for preferentially stimulating t-regulatory cells |
WO2024008891A1 (en) | 2022-07-07 | 2024-01-11 | Cambridge Enterprise Limited | Methods for mapping binding sites of compounds |
WO2024015953A1 (en) | 2022-07-15 | 2024-01-18 | Danisco Us Inc. | Methods for producing monoclonal antibodies |
WO2024013727A1 (en) | 2022-07-15 | 2024-01-18 | Janssen Biotech, Inc. | Material and methods for improved bioengineered pairing of antigen-binding variable regions |
WO2024023368A1 (en) | 2022-07-29 | 2024-02-01 | 4TEEN4 Pharmaceuticals GmbH | Prediction of an increase of dpp3 in a patient with septic shock |
WO2024023369A1 (en) | 2022-07-29 | 2024-02-01 | Adrenomed Ag | Anti-adrenomedullin (adm) antibody or anti-adm antibody fragment or anti-adm non-ig scaffold for use in therapy or prevention of shock |
WO2024030976A2 (en) | 2022-08-03 | 2024-02-08 | Voyager Therapeutics, Inc. | Compositions and methods for crossing the blood brain barrier |
WO2024050354A1 (en) | 2022-08-31 | 2024-03-07 | Washington University | Alphavirus antigen binding antibodies and uses thereof |
WO2024050524A1 (en) | 2022-09-01 | 2024-03-07 | University Of Georgia Research Foundation, Inc. | Compositions and methods for directing apolipoprotein l1 to induce mammalian cell death |
WO2024050526A1 (en) | 2022-09-02 | 2024-03-07 | Biomarin Pharmaceutical Inc. | Compositions and methods for treating long qt syndrome |
WO2024054436A1 (en) | 2022-09-06 | 2024-03-14 | Alexion Pharmaceuticals, Inc. | Diagnostic and prognostic biomarker profiles in patients with hematopoietic stem cell transplant-associated thrombotic microangiopathy (hsct-tma) |
WO2024052503A1 (en) | 2022-09-08 | 2024-03-14 | Institut National de la Santé et de la Recherche Médicale | Antibodies having specificity to ltbp2 and uses thereof |
WO2024056668A1 (en) | 2022-09-12 | 2024-03-21 | Institut National de la Santé et de la Recherche Médicale | New anti-itgb8 antibodies and its uses thereof |
WO2024059708A1 (en) | 2022-09-15 | 2024-03-21 | Abbott Laboratories | Biomarkers and methods for differentiating between mild and supermild traumatic brain injury |
WO2024062038A1 (en) | 2022-09-21 | 2024-03-28 | Elthera Ag | Novel binding molecules binding to l1cam |
WO2024068572A1 (en) | 2022-09-28 | 2024-04-04 | F. Hoffmann-La Roche Ag | Improved protease-activatable t cell bispecific antibodies |
WO2024068705A1 (en) | 2022-09-29 | 2024-04-04 | F. Hoffmann-La Roche Ag | Protease-activated polypeptides |
EP4345109A1 (en) | 2022-09-30 | 2024-04-03 | AdrenoMed AG | Anti-adrenomedullin (adm) binder for use in therapy of pediatric patients with congenital heart disease |
WO2024079711A1 (en) | 2022-10-14 | 2024-04-18 | Janssen Research & Development, Llc | Method for detection of antibody-dependent cellular phagocytosis |
Citations (34)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4593002A (en) * | 1982-01-11 | 1986-06-03 | Salk Institute Biotechnology/Industrial Associates, Inc. | Viruses with recombinant surface proteins |
US4704692A (en) * | 1986-09-02 | 1987-11-03 | Ladner Robert C | Computer based system and method for determining and displaying possible chemical structures for converting double- or multiple-chain polypeptides to single-chain polypeptides |
US4816397A (en) * | 1983-03-25 | 1989-03-28 | Celltech, Limited | Multichain polypeptides or proteins and processes for their production |
US5091513A (en) * | 1987-05-21 | 1992-02-25 | Creative Biomolecules, Inc. | Biosynthetic antibody binding sites |
US5223409A (en) * | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
US5258289A (en) * | 1990-09-05 | 1993-11-02 | Davis Claude G | Method for the selecting of genes encoding catalytic antibodies |
US5260203A (en) * | 1986-09-02 | 1993-11-09 | Enzon, Inc. | Single polypeptide chain binding molecules |
US5427908A (en) * | 1990-05-01 | 1995-06-27 | Affymax Technologies N.V. | Recombinant library screening methods |
US5534617A (en) * | 1988-10-28 | 1996-07-09 | Genentech, Inc. | Human growth hormone variants having greater affinity for human growth hormone receptor at site 1 |
US5561610A (en) * | 1994-06-30 | 1996-10-01 | Caterpillar Inc. | Method and apparatus for indicating a fault condition |
US5658727A (en) * | 1991-04-10 | 1997-08-19 | The Scripps Research Institute | Heterodimeric receptor libraries using phagemids |
US5688666A (en) * | 1988-10-28 | 1997-11-18 | Genentech, Inc. | Growth hormone variants with altered binding properties |
US5698426A (en) * | 1990-09-28 | 1997-12-16 | Ixsys, Incorporated | Surface expression libraries of heteromeric receptors |
US5750373A (en) * | 1990-12-03 | 1998-05-12 | Genentech, Inc. | Enrichment method for variant proteins having altered binding properties, M13 phagemids, and growth hormone variants |
US5770356A (en) * | 1992-09-04 | 1998-06-23 | The Scripps Research Institute | Phagemids coexpressing a surface receptor and a surface heterologous protein |
US5780279A (en) * | 1990-12-03 | 1998-07-14 | Genentech, Inc. | Method of selection of proteolytic cleavage sites by directed evolution and phagemid display |
US5780225A (en) * | 1990-01-12 | 1998-07-14 | Stratagene | Method for generating libaries of antibody genes comprising amplification of diverse antibody DNAs and methods for using these libraries for the production of diverse antigen combining molecules |
US5814476A (en) * | 1985-03-30 | 1998-09-29 | Stuart Kauffman | Process for the production of stochastically-generated transcription or translation products |
US5837242A (en) * | 1992-12-04 | 1998-11-17 | Medical Research Council | Multivalent and multispecific binding proteins, their manufacture and use |
US5840479A (en) * | 1990-02-01 | 1998-11-24 | Behring Diagnostics Gmbh | Preparation and use of gene banks of synthetic human antibodies ("synthetic human-antibody libraries") |
US5849500A (en) * | 1991-07-08 | 1998-12-15 | Deutsches Krebsforschungszentrum Stiftung Des Offentlichen Rechts | Phagemid for antibody screening |
US5855885A (en) * | 1993-01-22 | 1999-01-05 | Smith; Rodger | Isolation and production of catalytic antibodies using phage technology |
US5858657A (en) * | 1992-05-15 | 1999-01-12 | Medical Research Council | Methods for producing members of specific binding pairs |
US5871907A (en) * | 1991-05-15 | 1999-02-16 | Medical Research Council | Methods for producing members of specific binding pairs |
US5885793A (en) * | 1991-12-02 | 1999-03-23 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
US5935823A (en) * | 1990-02-15 | 1999-08-10 | The University Of North Carolina At Chapel Hill | Totally synthetic affinity reagents |
US5948635A (en) * | 1990-02-15 | 1999-09-07 | University Of North Carolina At Chapel Hill | Totally Synthetic Affinity Reagents |
US5955358A (en) * | 1990-12-20 | 1999-09-21 | Ixsys, Incorporated | Optimization of binding proteins |
US5969108A (en) * | 1990-07-10 | 1999-10-19 | Medical Research Council | Methods for producing members of specific binding pairs |
US6172197B1 (en) * | 1991-07-10 | 2001-01-09 | Medical Research Council | Methods for producing members of specific binding pairs |
US6225447B1 (en) * | 1991-05-15 | 2001-05-01 | Cambridge Antibody Technology Ltd. | Methods for producing members of specific binding pairs |
US6331415B1 (en) * | 1983-04-08 | 2001-12-18 | Genentech, Inc. | Methods of producing immunoglobulins, vectors and transformed host cells for use therein |
US6916605B1 (en) * | 1990-07-10 | 2005-07-12 | Medical Research Council | Methods for producing members of specific binding pairs |
US7063943B1 (en) * | 1990-07-10 | 2006-06-20 | Cambridge Antibody Technology | Methods for producing members of specific binding pairs |
Family Cites Families (18)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CA1277931C (en) | 1984-06-05 | 1990-12-18 | Shimon Ulitzur | Detection and/or identification of microorganisms in a test sample usingbioluminescence or other exogenous genetically-introduced marker |
EP0281604B1 (en) | 1986-09-02 | 1993-03-31 | Enzon Labs Inc. | Single polypeptide chain binding molecules |
US4946778A (en) * | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
US5567610A (en) | 1986-09-04 | 1996-10-22 | Bioinvent International Ab | Method of producing human monoclonal antibodies and kit therefor |
DE3852304T3 (en) | 1987-03-02 | 1999-07-01 | Enzon Lab Inc | Organism as carrier for "Single Chain Antibody Domain (SCAD)". |
ATE120761T1 (en) * | 1987-05-21 | 1995-04-15 | Creative Biomolecules Inc | MULTIFUNCTIONAL PROTEINS WITH PREDEFINED TARGET. |
DE3744595A1 (en) * | 1987-12-31 | 1989-07-13 | Andreas Dr Plueckthun | METHOD FOR THE GENETIC ENGINEERING OF ANTIBODY |
DE768377T1 (en) * | 1988-09-02 | 1998-01-02 | Dyax Corp | Production and selection of recombinant proteins with different binding sites |
KR0184860B1 (en) * | 1988-11-11 | 1999-04-01 | 메디칼 리써어치 카운실 | Single domain ligands receptors comprising said ligands methods for their production and use of said ligands |
CA2016841C (en) * | 1989-05-16 | 1999-09-21 | William D. Huse | A method for producing polymers having a preselected activity |
WO1990014443A1 (en) * | 1989-05-16 | 1990-11-29 | Huse William D | Co-expression of heteromeric receptors |
CA2016842A1 (en) * | 1989-05-16 | 1990-11-16 | Richard A. Lerner | Method for tapping the immunological repertoire |
AU7247191A (en) * | 1990-01-11 | 1991-08-05 | Molecular Affinities Corporation | Production of antibodies using gene libraries |
US5498538A (en) | 1990-02-15 | 1996-03-12 | The University Of North Carolina At Chapel Hill | Totally synthetic affinity reagents |
IL99552A0 (en) * | 1990-09-28 | 1992-08-18 | Ixsys Inc | Compositions containing procaryotic cells,a kit for the preparation of vectors useful for the coexpression of two or more dna sequences and methods for the use thereof |
ES2136092T3 (en) | 1991-09-23 | 1999-11-16 | Medical Res Council | PROCEDURES FOR THE PRODUCTION OF HUMANIZED ANTIBODIES. |
DE20114623U1 (en) | 2001-09-04 | 2004-02-12 | Wilken, Wilhelm, Dr. | Distal adapter for T5 fluorescent lamps with retrofit ECG |
US8464209B2 (en) | 2007-03-19 | 2013-06-11 | Microsoft Corporation | Using collaborative development information in a team environment |
-
1990
- 1990-07-10 GB GB909015198A patent/GB9015198D0/en active Pending
- 1990-10-19 GB GB909022845A patent/GB9022845D0/en active Pending
-
1991
- 1991-07-10 AT AT91913039T patent/ATE145237T1/en not_active IP Right Cessation
- 1991-07-10 US US07/971,857 patent/US5969108A/en not_active Expired - Lifetime
- 1991-07-10 EP EP91913039A patent/EP0589877B2/en not_active Expired - Lifetime
- 1991-07-10 ES ES91913039T patent/ES2096655T5/en not_active Expired - Lifetime
- 1991-07-10 EP EP04005419A patent/EP1433846B1/en not_active Expired - Lifetime
- 1991-07-10 DE DE69132920T patent/DE69132920C5/en not_active Expired - Lifetime
- 1991-07-10 AT AT96112510T patent/ATE212663T1/en not_active IP Right Cessation
- 1991-07-10 EP EP97120149A patent/EP0844306B1/en not_active Expired - Lifetime
- 1991-07-10 JP JP51235391A patent/JP3176917B2/en not_active Expired - Lifetime
- 1991-07-10 AT AT09001901T patent/ATE447023T1/en active
- 1991-07-10 DK DK96112510T patent/DK0774511T3/en active
- 1991-07-10 ES ES96112510T patent/ES2171581T3/en not_active Expired - Lifetime
- 1991-07-10 WO PCT/GB1991/001134 patent/WO1992001047A1/en active IP Right Grant
- 1991-07-10 DE DE69133545T patent/DE69133545T2/en not_active Expired - Lifetime
- 1991-07-10 EP EP07006223A patent/EP1847605A3/en not_active Withdrawn
- 1991-07-10 DE DE69133568T patent/DE69133568T2/en not_active Expired - Lifetime
- 1991-07-10 DE DE69133625T patent/DE69133625D1/en not_active Expired - Lifetime
- 1991-07-10 ES ES04005419T patent/ES2285292T3/en not_active Expired - Lifetime
- 1991-07-10 DK DK09001901.9T patent/DK2055777T3/en active
- 1991-07-10 ES ES97120149T patent/ES2275280T3/en not_active Expired - Lifetime
- 1991-07-10 DE DE122010000026C patent/DE122010000026I2/en active Active
- 1991-07-10 CA CA002086936A patent/CA2086936C/en not_active Expired - Lifetime
- 1991-07-10 DK DK91913039T patent/DK0589877T4/en active
- 1991-07-10 AT AT97120149T patent/ATE339497T1/en not_active IP Right Cessation
- 1991-07-10 ES ES09001901T patent/ES2322323T3/en not_active Expired - Lifetime
- 1991-07-10 AU AU82216/91A patent/AU664155B2/en not_active Expired
- 1991-07-10 AT AT04005419T patent/ATE358720T1/en not_active IP Right Cessation
- 1991-07-10 DK DK97120149T patent/DK0844306T3/en active
- 1991-07-10 AT AT06018386T patent/ATE542898T1/en active
- 1991-07-10 DE DE09001901T patent/DE09001901T1/en active Pending
- 1991-07-10 EP EP06018386A patent/EP1754787B1/en not_active Expired - Lifetime
- 1991-07-10 DE DE69123156T patent/DE69123156T3/en not_active Expired - Lifetime
- 1991-07-10 EP EP96112510A patent/EP0774511B1/en not_active Expired - Lifetime
- 1991-07-10 DK DK04005419T patent/DK1433846T3/en active
- 1991-07-10 EP EP09001901A patent/EP2055777B1/en not_active Revoked
-
1993
- 1993-01-09 KR KR1019930700061A patent/KR100222326B1/en not_active IP Right Cessation
-
1996
- 1996-12-20 GR GR960403561T patent/GR3022126T3/en unknown
-
1999
- 1999-10-13 US US09/416,902 patent/US7635666B1/en not_active Expired - Fee Related
- 1999-10-13 US US09/417,478 patent/US7723270B1/en not_active Expired - Fee Related
-
2006
- 2006-11-01 US US11/555,519 patent/US20070148774A1/en not_active Abandoned
- 2006-11-01 US US11/555,464 patent/US20090155810A1/en not_active Abandoned
-
2009
- 2009-11-03 NL NL300423C patent/NL300423I1/en unknown
- 2009-11-06 HK HK09110385.3A patent/HK1131637A1/en not_active IP Right Cessation
- 2009-11-10 LU LU91623C patent/LU91623I2/en unknown
-
2010
- 2010-05-03 US US12/772,829 patent/US20100317540A1/en not_active Abandoned
-
2011
- 2011-06-21 US US13/165,300 patent/US20120129710A1/en not_active Abandoned
Patent Citations (48)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4593002A (en) * | 1982-01-11 | 1986-06-03 | Salk Institute Biotechnology/Industrial Associates, Inc. | Viruses with recombinant surface proteins |
US4816397A (en) * | 1983-03-25 | 1989-03-28 | Celltech, Limited | Multichain polypeptides or proteins and processes for their production |
US6331415B1 (en) * | 1983-04-08 | 2001-12-18 | Genentech, Inc. | Methods of producing immunoglobulins, vectors and transformed host cells for use therein |
US5814476A (en) * | 1985-03-30 | 1998-09-29 | Stuart Kauffman | Process for the production of stochastically-generated transcription or translation products |
US4704692A (en) * | 1986-09-02 | 1987-11-03 | Ladner Robert C | Computer based system and method for determining and displaying possible chemical structures for converting double- or multiple-chain polypeptides to single-chain polypeptides |
US5260203A (en) * | 1986-09-02 | 1993-11-09 | Enzon, Inc. | Single polypeptide chain binding molecules |
US5091513A (en) * | 1987-05-21 | 1992-02-25 | Creative Biomolecules, Inc. | Biosynthetic antibody binding sites |
US5223409A (en) * | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
US5403484A (en) * | 1988-09-02 | 1995-04-04 | Protein Engineering Corporation | Viruses expressing chimeric binding proteins |
US5837500A (en) * | 1988-09-02 | 1998-11-17 | Dyax, Corp. | Directed evolution of novel binding proteins |
US5534617A (en) * | 1988-10-28 | 1996-07-09 | Genentech, Inc. | Human growth hormone variants having greater affinity for human growth hormone receptor at site 1 |
US5688666A (en) * | 1988-10-28 | 1997-11-18 | Genentech, Inc. | Growth hormone variants with altered binding properties |
US5780225A (en) * | 1990-01-12 | 1998-07-14 | Stratagene | Method for generating libaries of antibody genes comprising amplification of diverse antibody DNAs and methods for using these libraries for the production of diverse antigen combining molecules |
US5840479A (en) * | 1990-02-01 | 1998-11-24 | Behring Diagnostics Gmbh | Preparation and use of gene banks of synthetic human antibodies ("synthetic human-antibody libraries") |
US5935823A (en) * | 1990-02-15 | 1999-08-10 | The University Of North Carolina At Chapel Hill | Totally synthetic affinity reagents |
US5948635A (en) * | 1990-02-15 | 1999-09-07 | University Of North Carolina At Chapel Hill | Totally Synthetic Affinity Reagents |
US5427908A (en) * | 1990-05-01 | 1995-06-27 | Affymax Technologies N.V. | Recombinant library screening methods |
US5580717A (en) * | 1990-05-01 | 1996-12-03 | Affymax Technologies N.V. | Recombinant library screening methods |
US7063943B1 (en) * | 1990-07-10 | 2006-06-20 | Cambridge Antibody Technology | Methods for producing members of specific binding pairs |
US6916605B1 (en) * | 1990-07-10 | 2005-07-12 | Medical Research Council | Methods for producing members of specific binding pairs |
US5969108A (en) * | 1990-07-10 | 1999-10-19 | Medical Research Council | Methods for producing members of specific binding pairs |
US5258289A (en) * | 1990-09-05 | 1993-11-02 | Davis Claude G | Method for the selecting of genes encoding catalytic antibodies |
US5698426A (en) * | 1990-09-28 | 1997-12-16 | Ixsys, Incorporated | Surface expression libraries of heteromeric receptors |
US5821047A (en) * | 1990-12-03 | 1998-10-13 | Genentech, Inc. | Monovalent phage display |
US5780279A (en) * | 1990-12-03 | 1998-07-14 | Genentech, Inc. | Method of selection of proteolytic cleavage sites by directed evolution and phagemid display |
US5846765A (en) * | 1990-12-03 | 1998-12-08 | Genentech, Inc. | Identification of novel substrates |
US5750373A (en) * | 1990-12-03 | 1998-05-12 | Genentech, Inc. | Enrichment method for variant proteins having altered binding properties, M13 phagemids, and growth hormone variants |
US5955358A (en) * | 1990-12-20 | 1999-09-21 | Ixsys, Incorporated | Optimization of binding proteins |
US5658727A (en) * | 1991-04-10 | 1997-08-19 | The Scripps Research Institute | Heterodimeric receptor libraries using phagemids |
US5759817A (en) * | 1991-04-10 | 1998-06-02 | The Scripps Research Institute | Heterodimeric receptor libraries using phagemids |
US5871907A (en) * | 1991-05-15 | 1999-02-16 | Medical Research Council | Methods for producing members of specific binding pairs |
US6291650B1 (en) * | 1991-05-15 | 2001-09-18 | Cambridge Antibody Technology, Ltd. | Methods for producing members of specific binding pairs |
US6225447B1 (en) * | 1991-05-15 | 2001-05-01 | Cambridge Antibody Technology Ltd. | Methods for producing members of specific binding pairs |
US5849500A (en) * | 1991-07-08 | 1998-12-15 | Deutsches Krebsforschungszentrum Stiftung Des Offentlichen Rechts | Phagemid for antibody screening |
US5985588A (en) * | 1991-07-08 | 1999-11-16 | Deutsches Krebsforschungszentrum Stiftung Des Offentlichen Rechts | Phagemid for antibody screening |
US6172197B1 (en) * | 1991-07-10 | 2001-01-09 | Medical Research Council | Methods for producing members of specific binding pairs |
US6582915B1 (en) * | 1991-12-02 | 2003-06-24 | Medical Research Council | Production of anti-self bodies from antibody segment repertories and displayed on phage |
US6521404B1 (en) * | 1991-12-02 | 2003-02-18 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
US6544731B1 (en) * | 1991-12-02 | 2003-04-08 | Medical Research Council | Production of anti-self antibodies from antibody segment repertories and displayed on phage |
US6555313B1 (en) * | 1991-12-02 | 2003-04-29 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
US6593081B1 (en) * | 1991-12-02 | 2003-07-15 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
US5885793A (en) * | 1991-12-02 | 1999-03-23 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
US7195866B2 (en) * | 1991-12-02 | 2007-03-27 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
US5858657A (en) * | 1992-05-15 | 1999-01-12 | Medical Research Council | Methods for producing members of specific binding pairs |
US5770356A (en) * | 1992-09-04 | 1998-06-23 | The Scripps Research Institute | Phagemids coexpressing a surface receptor and a surface heterologous protein |
US5837242A (en) * | 1992-12-04 | 1998-11-17 | Medical Research Council | Multivalent and multispecific binding proteins, their manufacture and use |
US5855885A (en) * | 1993-01-22 | 1999-01-05 | Smith; Rodger | Isolation and production of catalytic antibodies using phage technology |
US5561610A (en) * | 1994-06-30 | 1996-10-01 | Caterpillar Inc. | Method and apparatus for indicating a fault condition |
Cited By (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2009102927A1 (en) * | 2008-02-13 | 2009-08-20 | Dyax Corp. | Improved methods for producing specific binding pairs |
US20090215119A1 (en) * | 2008-02-13 | 2009-08-27 | Dyax Corp. | Methods for producing specific binding pairs |
US11793843B2 (en) | 2019-01-10 | 2023-10-24 | Janssen Biotech, Inc. | Prostate neoantigens and their uses |
Also Published As
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US6916605B1 (en) | Methods for producing members of specific binding pairs | |
US7635666B1 (en) | Methods for producing members of specific binding pairs | |
US6172197B1 (en) | Methods for producing members of specific binding pairs | |
US7063943B1 (en) | Methods for producing members of specific binding pairs | |
CA2109602C (en) | Methods for producing members of specific binding pairs | |
US6225447B1 (en) | Methods for producing members of specific binding pairs | |
US5871907A (en) | Methods for producing members of specific binding pairs | |
US5858657A (en) | Methods for producing members of specific binding pairs | |
EP0656941B1 (en) | Methods for producing members of specific binding pairs |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AS | Assignment |
Owner name: MEDIMMUNE LIMITED, UNITED KINGDOM Free format text: CHANGE OF NAME;ASSIGNOR:CAMBRIDGE ANTIBODY TECHNOLOGY LIMITED;REEL/FRAME:023379/0089 Effective date: 20071029 Owner name: MEDIMMUNE LIMITED,UNITED KINGDOM Free format text: CHANGE OF NAME;ASSIGNOR:CAMBRIDGE ANTIBODY TECHNOLOGY LIMITED;REEL/FRAME:023379/0089 Effective date: 20071029 |
|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |