WO2003045422A1 - Agonists and antagonists of prolixin for the treatment of metabolic disorders - Google Patents

Agonists and antagonists of prolixin for the treatment of metabolic disorders Download PDF

Info

Publication number
WO2003045422A1
WO2003045422A1 PCT/IB2002/004668 IB0204668W WO03045422A1 WO 2003045422 A1 WO2003045422 A1 WO 2003045422A1 IB 0204668 W IB0204668 W IB 0204668W WO 03045422 A1 WO03045422 A1 WO 03045422A1
Authority
WO
WIPO (PCT)
Prior art keywords
activity
prolixin
polypeptide
ligand
insulin
Prior art date
Application number
PCT/IB2002/004668
Other languages
French (fr)
Inventor
John Lucas
Deno Dialynas
Kristen Briggs
Original Assignee
Genset S.A.
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Genset S.A. filed Critical Genset S.A.
Priority to AU2002339691A priority Critical patent/AU2002339691A1/en
Priority to EP02777740A priority patent/EP1448226A1/en
Priority to US10/496,757 priority patent/US7344843B2/en
Publication of WO2003045422A1 publication Critical patent/WO2003045422A1/en

Links

Classifications

    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/92Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving lipids, e.g. cholesterol, lipoproteins, or their receptors
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/177Receptors; Cell surface antigens; Cell surface determinants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/566Immunoassay; Biospecific binding assay; Materials therefor using specific carrier or receptor proteins as ligand binding reagents where possible specific carrier or receptor proteins are classified with their target compounds
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/435Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
    • G01N2333/705Assays involving receptors, cell surface antigens or cell surface determinants
    • G01N2333/70578NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30 CD40 or CD95
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2500/00Screening for compounds of potential therapeutic value
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/04Endocrine or metabolic disorders
    • G01N2800/044Hyperlipemia or hypolipemia, e.g. dyslipidaemia, obesity

Definitions

  • the present invention relates to the field of metabolic research, in particular the discovery of compounds effective for reducing body mass and maintaining weight loss and useful for treating obesity-related diseases and disorders.
  • the obesity-related diseases or disorders envisioned to be treated by the methods of the invention include, but are not limited to, hyperlipidemia, atherosclerosis, insulin resistance, diabetes, and hypertension.
  • the present invention additionally 0 relates elsewhere to the field of metabolic research, in particular the discovery of compounds effective for increasing body mass and useful for treating disorders associated with excessive weight loss. Applicant reserves the right to exclude any of the aforesaid obesity-related diseases or disorders.
  • disorders associated with excessive weight loss and envisioned to be treated by the methods of the invention include, but are not limited to, cachexia, cancer-related weight loss, ATDS- 5 related weight loss, chronic inflammatory disease-related weight loss, and anorexia. Applicant reserves the right to exclude any of the aforesaid disorders associated with excessive weight loss.
  • the invention provides for methods of identifying and using AGONISTS and ANTAGONISTS of PROLIXIN activity, wherein said activity is selected from the group consisting of lipid partitioning, lipid metabolism, and insulin-like activity.
  • Obesity is a public health problem that is serious, widespread, and increasing. In the United States, 20 percent of the population is obese; in Europe, a slightly lower percentage is obese 5 (Friedman (2000) Nature 404:632-634). Obesity is associated with increased risk of hypertension, cardiovascular disease, diabetes, and cancer as well as respiratory complications and osteoarthritis (Kopelman (2000) Nature 404:635-643). Even modest weight loss ameliorates these associated conditions.
  • ACRP30 full-length 0 ACRP30 (mouse) and APMl (human) polypeptides
  • effects of ACRP30 fragment administration in mammals also include reduction of elevated free fatty acid levels including elevated free fatty acid levels caused by administration of eprnephrine, i.v. injection of "intralipid", or administration of a high fat test meal, as well as increased fatty acid oxidation in muscle cells, and weight reduction in mammals consuming a normal or high fat/high sucrose diet.
  • APMl belongs to an expanding family of related secreted polypeptides that includes among others C2P, ZADJ-2 and ZADJ-7. These polypeptides have in common the structure: signal peptide, N-terminally disposed unique region, collagen-like region, and globular C-terminal Clq homology domain. APMl, C2P, ZADJ-2 and ZADJ-7 further share an NGLXXD amino acid motif C-terminally disposed within the globular domain within a loop implicated in receptor binding, wherein said receptor is PROLIXIN.
  • LIGAND refers to a composition consisting essentially of or consisting of in vitro or in vivo self-assembling homotrimer comprised of gAPMl, gC2P, gZADJ-2, or gZADJ-7 polypeptide fragment.
  • PROLIXIN is a member of the Tumor Necrosis Factor Receptor Super Family (TNFRSF) and is a Type Ul transmembrane protein.
  • the instant invention is based on PROLLXIN as receptor for LIGAND that mediates effects, including utility for weight reduction, maintenance of weight loss, prevention of weight gain, increased insulin sensitivity, and control of blood glucose levels in humans and other mammals.
  • effects in mammals of PROLIXIN engagement by LIGAND also include reduction of elevated free fatty acid levels including elevated free fatty acid levels including elevated free fatty acid levels caused by administration of epinephrine, i.v.
  • the present invention is directed to PROLIXIN to which LIGAND binds and through which LIGAND mediates said effects.
  • the invention provides for methods of identifying and using AGONISTS and ANTAGONISTS of PROLIXIN activity, wherein said activity is selected from the group consisting of lipid partitioning, lipid metabolism, and insulin-like activity, as well as to pharmaceutical and physiologically acceptable compositions comprising said PROLLXIN AGONISTS or ANTAGONISTS and methods of administering said pharmaceutical and physiologically acceptable compositions in order to increase or reduce body weight, maintain weight loss, or to treat obesity- related diseases and disorders.
  • Assays for identifying AGONISTS and ANTAGONISTS of obesity- related activity are also part of the invention.
  • PROLIXIN AGONIST or ANTAGONIST is a compound selected from the group consisting of polypeptide, polypeptide fragment, peptide, proein, antibody, carbohydrate, lipid, small molecular weight organic compound and small molecular weight inorganic compound.
  • PROLIXIN AGONIST or ANTAGONIST is a compound that selectively binds to the extracellular domain of PROLIXIN.
  • said PROLIXIN AGONIST or ANTAGONIST is a compound that selectively binds to the intracellular domain of a polypeptide comprising the extracellular domain of PROLIXIN.
  • the present invention also provides a method of assaying test compounds to identify a test compound that binds to PROLIXIN polypeptide.
  • the method comprises contacting PROLIXIN polypeptide with a test compound and to determine the extent of binding of the test compound to said PROLLXIN polypeptide.
  • the method further comprises determining whether such test compounds are AGONISTS or ANTAGONISTS of PROLIXIN polypeptide.
  • the present invention further provides a method of testing the impact of molecules on the expression of PROLLXIN polypeptide or on the activity of PROLLXIN polypeptide .
  • the present invention also relates to diagnostic methods of identifying individuals or non- human animals having elevated or reduced levels of PROLLXIN products, which individuals are likely to benefit from therapies to suppress or enhance PROLIXIN expression, respectively, and to methods of identifying individuals or non-human animals at increased risk for developing, or present state of having, certain diseases/disorders associated with PROLLXIN abnormal expression or biological activity.
  • the present invention provides for methods of identifying AGONISTS of PROLLXIN polypeptide biological activity comprising contacting a small molecule compound with PROLLXIN polypeptides and measuring PROLLXF polypeptide biological activity in the presence and absence of these small molecules.
  • the present invention further provides for methods of identifying ANTAGONISTS of PROLIXIN polypeptide biological activity comprising contacting a small molecule compound with PROLIXIN polypeptides and measuring PROLLXIN polypeptide biological activity in the presence and absence of these small molecules.
  • These small molecules can be a naturally occurring medicinal compound or derived from combinatorial chemical libraries.
  • the present invention also relates to pharmaceutical or physiologically acceptable compositions comprising, an active agent, including AGONIST or ANTAGONIST of the present invention.
  • the invention is directed to PROLIXIN AGONISTS, wherein said AGONIST is an antibody that specifically binds PROLIXIN, a compound excluding said PROLIXIN antibody (e.g., small organic or inorganic compound, protein, peptide, carbohydrate, lipid), or a LIGAND polypeptide or fragment thereof.
  • AGONIST is an antibody that specifically binds PROLIXIN, a compound excluding said PROLIXIN antibody (e.g., small organic or inorganic compound, protein, peptide, carbohydrate, lipid), or a LIGAND polypeptide or fragment thereof.
  • the invention is directed to a PROLLXIN AGONIST, wherein said AGONIST is an antibody that specifically binds PROLIXIN. More preferably the invention is directed to said PROLLXIN antibody, wherein said PROLLXIN antibody binds
  • PROLIXIN and manifests LIGAND activity wherein said activity is selected from the group consisting of lipid partitioning, lipid metabolism, and insulin-like activity or described herein.
  • the invention is directed to a PROLIXIN AGONIST, wherein said AGONIST is a compound excluding said PROLLXIN antibody. More preferably the invention is directed to said compound, wherein said compound binds PROLIXIN and manifests LIGAND activity, wherein said activity is selected from the group consisting of lipid partitioning, lipid metabolism, and insulin-like activity or described herein. Further more preferably the invention is directed to said compound, wherein said compound manifests LIGAND activity exclusive of binding to PROLIXIN, wherein said activity is selected from the group consisting of lipid partitioning, lipid metabolism, and insulin-like activity or described herein. Further more preferably the invention is directed to said compound, wherein said compound increases PROLLXIN expression.
  • the invention is directed to a PROLIXIN AGONIST that selectively binds to a polypeptide comprising the extracellular domain of PROLLXIN.
  • the invention is directed to a PROLLXIN AGONIST, wherein said AGONIST is LIGAND, and wherein it is understood that LIGAND refers to a composition consisting essentially of or consisting of in vitro or in vivo self-assembling homotrimer comprised of gAPMl, gC2P, gZADJ-2, or gZADJ-7 polypeptide fragment.
  • the invention is directed to said LIGAND, wherein said LIGAND binds PROLIXIN and elicits biological activity, wherein said activity is selected from the group consisting of lipid partitioning, lipid metabolism, and insulin-like activity or described herein. More preferably the invention is directed to said LIGAND, wherein said LIGAND induces, enhances, or potentiates said biological activity exclusive of binding to PROLLXIN.
  • said homotrimer is comprised of preferred gAPMl, gC2P, gZADJ-2 or gZADJ-7 polypeptide fragment.
  • APMl. Preferred gAPMl polypeptide fragment is selected from amino acids 18-244, 34-
  • Preferred gZADJ-2 polypeptide fragment is selected from amino acids 16-285, 25- 285, 26-285, 29-285, 30-285, 91-285, 93-285, 97-285, 98-285, 99-285, 105-285, 109-285, 112-285, 120-285, 126-285, 127-285, 130-285, 132-285, 133-285, 134-285, or 150-285, wherein said numbering of said amino acids within ZADJ-2 amino acid sequence is understood to be taken from 10 said ZADJ-2 amino acid sequence presented in Table 2. Less preferred gZADJ-2 fragments are indicated in bold.
  • ZADJ-7 Preferred gZADJ-7 polypeptide fragment is selected from amino acids 31-303, 39-
  • ZADJ-7 amino acid sequence 15 within ZADJ-7 amino acid sequence is understood to be taken from said ZADJ-7 amino acid sequence presented in Table 2. Less preferred gZADJ-7 fragments are indicated in bold.
  • More preferred LIGAND is APMl.
  • said AGONIST is able to lower circulating (either blood, serum or plasma) levels (concentration) of: (i) free fatty acids, (ii) glucose, and/or (iii) triglycerides.
  • Further preferred AGONISTS are those that significantly stimulate muscle lipid or free fatty acid oxidation as compared to untreated cells. Further preferred AGONISTS are those that cause C2C12 cells differentiated in the presence of said AGONISTS to undergo at least 10%, 20%, 30%, 35%, or 40% more oleate oxidation as compared to untreated cells.
  • AGONISTS are those that increase by at least 10%, 20%, 30%, 35%, or 25 40% leptin uptake in a liver cell line [preferably BPRCL mouse liver cells (ATCC CRL-2217)] as compared to untreated cells.
  • AGONISTS are those that significantly reduce the postprandial increase in plasma free fatty acids or triglycerides, particularly following a high fat meal.
  • AGONISTS are those that significantly reduce or eliminate ketone body 30 production, particularly following a high fat meal.
  • AGONISTS are those that increase glucose uptake in skeletal muscle cells.
  • AGONISTS are those that increase glucose uptake in adipose cells.
  • AGONISTS are those that increase glucose uptake in neuronal cells.
  • AGONISTS are those that increase glucose uptake in red blood cells. Further preferred AGONISTS are those that increase glucose uptake in the brain.
  • AGONISTS are those that significantly reduce the postprandial increase in plasma glucose following a meal, particularly a high carbohydrate meal.
  • AGONISTS are those that significantly prevent the postprandial increase in plasma glucose following a meal, particularly a high fat or a high carbohydrate meal.
  • AGONISTS are those that improve insulin sensitivity.
  • AGONISTS are those that decrease body mass, wherein said decrease in body mass is comprised of a change in mass of the subcutaneous adipose tissue.
  • AGONISTS are those that decrease body mass, wherein said decrease in body mass is comprised of a change in mass of the visceral (omental) adipose tissue.
  • the invention features a pharmaceutical or physiologically acceptable composition
  • a pharmaceutical or physiologically acceptable composition comprising, consisting essentially of, or consisting of, said AGONIST described in the first aspect and, alternatively, a pharmaceutical or physiologically acceptable diluent.
  • the invention features a method of reducing body mass comprising providing or administering to individuals in need of reducing body mass said pharmaceutical or physiologically acceptable composition described in the second aspect.
  • the invention features a method of preventing or treating an obesity- related disease or disorder comprising providing or administering to an individual in need of such treatment said pharmaceutical or physiologically acceptable composition described in the second aspect.
  • said obesity-related disease or disorder is selected from the group consisting of obesity, insulin resistance, atherosclerosis, atheromatous disease, heart disease, hypertension, stroke, Syndrome X, Noninsulin Dependent Diabetes Mellitus (NIDDM, or Type II diabetes) and Insulin Dependent Diabetes Mellitus (IDDM or Type I diabetes).
  • Diabetes-related complications to be treated by the methods of the invention include microangiopathic lesions, ocular lesions, retinopathy, neuropathy, and renal lesions.
  • Heart disease includes, but is not limited to, cardiac insufficiency, coronary insufficiency, and high blood pressure.
  • Other obesity-related disorders to be treated by said PROLLXIN AGONIST of the invention include hyperlipidemia and hyperuricemia.
  • said individual is a mammal, preferably a human.
  • embodiments of the present invention includes methods of causing or inducing a desired biological response in an individual comprising the steps of: providing or administering to an individual a composition comprising AGONIST, wherein said biological response is selected from the group consisting of:
  • the present invention of said pharmaceutical or physiologically acceptable composition can be used as a method to control blood glucose in some persons with Noninsulin Dependent Diabetes Mellitus (NTDDM, Type II diabetes) in combination with insulin therapy.
  • NTDDM Noninsulin Dependent Diabetes Mellitus
  • the present invention of said pharmaceutical or physiologically acceptable composition can be used as a method to control blood glucose in some persons with Insulin Dependent Diabetes Mellitus (IDDM, Type I diabetes) in combination with insulin therapy.
  • IDDM Insulin Dependent Diabetes Mellitus
  • the present invention of said pharmaceutical or physiologically acceptable composition can be used as a method to control body weight in some persons with Noninsulin Dependent Diabetes Mellitus (NIDDM, Type II diabetes) in combination with insulin therapy.
  • NIDDM Noninsulin Dependent Diabetes Mellitus
  • the present invention of said pharmaceutical or physiologically acceptable composition can be used as a method to control body weight in some persons with Insulin Dependent Diabetes Mellitus (IDDM, Type I diabetes) in combination with insulin therapy.
  • IDDM Insulin Dependent Diabetes Mellitus
  • the present invention of said pharmaceutical or physiologically acceptable composition can be used as a method to control blood glucose in some persons with Noninsulin Dependent Diabetes Mellitus (NIDDM, Type II diabetes) alone, without combination of insulin therapy.
  • NIDDM Noninsulin Dependent Diabetes Mellitus
  • the present invention of said pharmaceutical or physiologically acceptable composition can be used as a method to control blood glucose in some persons with Insulin Dependent Diabetes Mellitus (IDDM, Type I diabetes) alone, without combination of insulin therapy.
  • the present invention of said pharmaceutical or physiologically acceptable composition can be used as a method to control body weight in some persons with Noninsulin Dependent Diabetes Mellitus (NIDDM, Type II diabetes) alone, without combination of insulin therapy.
  • the present invention of said pharmaceutical or physiologically acceptable composition can be used as a method to control body weight in some persons with Insulin Dependent Diabetes Mellitus (IDDM, Type I diabetes) alone, without combination of insulin therapy.
  • IDDM Insulin Dependent Diabetes Mellitus
  • the present invention may be used in complementary therapy of NEDDM patients to improve their weight or glucose control in combination with an insulin secretagogue or an insulin sensitising agent.
  • the insulin secretagogue is 1,1- dimethyl-2-(2-mo holino phenyl)guanidine fumarate (BTS67582) or a sulphonylurea selected from tolbutamide, tolazamide, chlorpropamide, glibenclamide, glimepiride, glipizide and glidazide.
  • the insulin sensitising agent is selected from metformin, ciglitazone, troglitazone and pioglitazone.
  • the present invention further provides a method of improving the body weight or glucose control of NTDDM patients alone, without an insulin secretagogue or an insulin sensitising agent.
  • the present invention may be used in complementary therapy of IDDM patients to improve their weight or glucose control in combination with an insulin secretagogue or an insulin sensitising agent.
  • the insulin secretagogue is l,l-dimethyl-2- (2-morpholino phenyl) guanidine fumarate (BTS67582) or a sulphonylurea selected from tolbutamide, tolazamide, chlo ⁇ ropamide, glibenclamide, glimepiride, glipizide and glidazide.
  • the insulin sensitising agent is selected from metformin, ciglitazone, troglitazone and pioglitazone.
  • the present invention further provides a method of improving the body weight or glucose control of IDDM patients alone, without an insulin secretagogue or an insulin sensitising agent.
  • the present invention may be administered either concomitantly or concurrently, with the insulin secretagogue or insulin sensitising agent for example in the form of separate dosage units to be used simultaneously, separately or sequentially (either before or after the secretagogue or either before or after the sensitising agent).
  • the present invention further provides for a composition of pharmaceutical or physiologically acceptable composition and an insulin secretagogue or insulin sensitising agent as a combined preparation for simultaneous, separate or sequential use for the improvement of body weight or glucose control in NIDDM or IDDM patients.
  • the present invention of said pharmaceutical or physiologically acceptable composition further provides a method for the use as an insulin sensitiser.
  • the present invention of said pharmaceutical or physiologically acceptable composition can be used as a method to improve insulin sensitivity in some persons with Noninsulin Dependent Diabetes Mellitus (NIDDM, Type II diabetes) in combination with insulin therapy.
  • NIDDM Noninsulin Dependent Diabetes Mellitus
  • the present invention of said pharmaceutical or physiologically acceptable composition can be used as a method to improve insulin sensitivity in some persons with Insulin Dependent Diabetes Mellitus (IDDM, Type I diabetes) in combination with insulin therapy.
  • IDDM Insulin Dependent Diabetes Mellitus
  • the present invention of said pharmaceutical or physiologically acceptable composition can be used as a method to improve insulin sensitivity in some persons with Noninsulin Dependent Diabetes Mellitus (NIDDM, Type II diabetes) without insulin therapy.
  • NIDDM Noninsulin Dependent Diabetes Mellitus
  • the invention features a use of AGONIST described in the first aspect for treatment of obesity-related diseases and disorders and/or reducing body mass.
  • said obesity-related diseases and disorders are selected from the group consisting of obesity, insulin resistance, atherosclerosis, atheromatous disease, heart disease, hypertension, stroke, Syndrome X, Noninsulin Dependent Diabetes Mellitus (NIDDM, or Type II diabetes) and Insulin Dependent Diabetes Mellitus (IDDM or Type I diabetes).
  • Diabetes-related complications to be treated by the methods of the invention include microangiopathic lesions, ocular lesions, retinopathy, neuropathy, and renal lesions.
  • Heart disease includes, but is not limited to, cardiac insufficiency, coronary insufficiency, and high blood pressure.
  • Other obesity-related disorders to be treated by said AGONIST of the invention include hyperlipidemia and hyperuricemia.
  • the invention features a use of AGONIST described in the first aspect for the preparation of a medicament for the treatment of obesity-related diseases and disorders and/or for reducing body mass.
  • said obesity-related disease or disorder is selected from the group consisting of obesity, insulin resistance, atherosclerosis, atheromatous disease, heart disease, hypertension, stroke, Syndrome X, Noninsulin Dependent Diabetes Mellitus (NIDDM, or Type II diabetes) and Insulin Dependent Diabetes Mellitus (IDDM or Type I diabetes).
  • Diabetes-related complications to be treated by the methods of the invention include microangiopathic lesions, ocular lesions, retinopathy, neuropathy, and renal lesions.
  • Heart disease includes, but is not limited to, cardiac insufficiency, coronary insufficiency, and high blood pressure.
  • Other obesity-related disorders to be treated by compounds of the invention include hyperlipidemia and hyperuricemia.
  • said individual is a mammal, preferably a human.
  • the invention provides AGONIST of the first aspect of the invention, or a composition of the second aspect of the invention, for use in a method of treatment of the human or animal body.
  • the invention features methods of reducing body weight comprising providing to an individual said pharmaceutical or physiologically acceptable composition described in the second aspect, or AGONIST described in the first aspect.
  • the individual has a BMI of at least 20 and no more than 25.
  • the individual may have a BMI of at least 20.
  • One embodiment for the treatment of obesity provides for the treatment of individuals with BMI values of at least 25.
  • Another embodiment for the treatment of obesity provides for the treatment of individuals with BMI values of at least 30.
  • Yet another embodiment provides for the treatment of individuals with BMI values of at least 40.
  • the invention features methods of maintaining weight loss comprising providing to an individual said pharmaceutical or physiologically acceptable composition.
  • the invention features the pharmaceutical or physiologically acceptable composition described in the second aspect for reducing body mass and/or for treatment or prevention of obesity-related diseases or disorders.
  • said obesity-related disease or disorder is selected from the group consisting of obesity, insulin resistance, atherosclerosis, atheromatous disease, heart disease, hypertension, stroke, Syndrome X, Noninsulin Dependent Diabetes Mellitus (NIDDM, or Type II diabetes) and Insulin Dependent Diabetes Mellitus (IDDM or Type I diabetes).
  • NIDDM Noninsulin Dependent Diabetes Mellitus
  • IDDM Insulin Dependent Diabetes Mellitus
  • Diabetes-related complications to be treated by the methods of the invention include microangiopathic lesions, ocular lesions, retinopathy, neuropathy, and renal lesions.
  • Heart disease includes, but is not limited to, cardiac insufficiency, coronary insufficiency, and high blood pressure.
  • Other obesity-related disorders to be treated by compounds of the invention include hyperlipidemia and hyperuricemia.
  • said individual is a mammal, preferably a human, hi preferred embodiments, the identification of said individuals to be treated with said pharmaceutical or physiologically acceptable composition comprises genotyping LIGAND single nucleotide polymorphisms (SNPs) or measuring LIGAND polypeptide or mRNA levels in clinical samples from said individuals.
  • said clinical samples are selected from the group consisting of blood, serum, plasma, urine, and saliva.
  • the invention features the pharmaceutical or physiologically acceptable composition described in the second aspect for reducing body weight for cosmetic reasons.
  • AGONIST of the invention is used in methods of treating insulin resistance comprising providing to an individual said pharmaceutical or physiologically acceptable composition described in the second aspect, or AGONIST described in the first aspect.
  • the amount of AGONIST administered to an individual is sufficient to bring levels of PROLIXIN activation to their normal levels (levels in individuals without obesity-related disease or disorder). "Normal levels" of
  • PROLIXIN activation may be followed using surrogate markers including circulating (either blood, serum or plasma) levels (concentration) of: (i) free fatty acids, (ii) glucose, and/or (iii) triglycerides.
  • surrogate markers including circulating (either blood, serum or plasma) levels (concentration) of: (i) free fatty acids, (ii) glucose, and/or (iii) triglycerides.
  • the invention is directed to a PROLIXIN ANTAGONIST, wherein said ANTAGONIST is a soluble fragment of PROLLXIN polypeptide, an antibody that specifically binds
  • PROLLXIN a compound excluding said soluble fragment of PROLIXIN polypeptide and said
  • PROLLXIN antibody e.g., small molecular weight organic or inorganic compound, protein, peptide, carbohydrate, lipid), or a variant or fragment of LIGAND polypeptide.
  • the invention is directed to a PROLIXIN ANTAGONIST, wherein said ANTAGONIST is a soluble fragment of PROLIXIN polypeptide. More preferably the invention is directed to purified, isolated, or recombinant soluble fragments of PROLIXIN polypeptide. More preferably the invention is directed to said soluble fragment of PROLIXIN polypeptide, wherein said soluble fragment binds LIGAND and blocks LIGAND activity, said activity being selected from the group consisting of lipid partitioning, lipid metabolism, and insulin-like activity or described herein, and wherein said soluble fragment of PROLIXIN polypeptide does not activate PROLLXIN.
  • said soluble fragment of PROLIXIN polypeptide blocks or inhibits LIGAND binding to PROLLXIN.
  • said soluble fragment of PROLIXIN polypeptide comprises, consists essentially of, or consists of, at least 6 and not more than 76 consecutive amino acids of SEQ ID NO:2, more preferably of amino acids comprising the extracellular domain of PROLLXIN.
  • Preferred said soluble fragment of PROLIXIN comprises the extracellular domain of mature PROLLXIN polypeptide.
  • Particularly preferred soluble fragment of PROLLXIN comprises amino acids 1-39, 2-39, 1-42, 2-42, 1-44, 2-44, 1-51, 2-51, 1-54, 2-54, 1-58, 2-58, 1-63, 2-63, 1-67, 2-67, 1-72, 2-72, 1-76 or 2-76 of SEQ ID NO:2.
  • said soluble fragment of PROLLXIN polypeptide comprises an amino acid sequence at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to the corresponding consecutive amino acids of SEQ ID NO:2.
  • Further preferred embodiments include heterologous polypeptides comprising a PROLLXF polypeptide of the invention.
  • a PROLLXIN polypeptide of the invention is conjugated at its N- or C- terminus to an antibody Fc region or portion thereof.
  • the invention is directed to a PROLIXIN
  • ANTAGONIST wherein said ANTAGONIST is an antibody that specifically binds PROLLXIN. More preferably the invention is directed to said PROLLXIN antibody, wherein said PROLIXIN antibody binds PROLLXIN and blocks LIGAND activity, said activity being selected from the group consisting of lipid partitioning, lipid metabolism, and insulin-like activity or described herein, and wherein said PROLIXIN antibody does not activate PROLLXP . Preferably said PROLLXIN antibody blocks or inhibits LIGAND binding to PROLLXIN.
  • the invention is directed to a PROLLXIN ANTAGONIST, wherein said ANTAGONIST is a compound excluding said soluble fragment of PROLIXIN polypeptide and said PROLIXIN antibody (e.g., small organic molecule, protein, peptide). More preferably the invention is directed to said compound, wherein said compound binds to PROLIXIN and blocks LIGAND activity, said activity being selected from the group consisting of lipid partitioning, lipid metabolism, and insulin-like activity or described herein, and wherein said compound does not activate PROLIXIN.
  • said compound that binds to PROLIXIN blocks or inhibits LIGAND binding to PROLIXIN.
  • the invention is directed to said compound, wherein said compound blocks or inhibits LIGAND activity exclusive of binding to PROLIXIN, said activity being selected from the group consisting of lipid partitioning, lipid metabolism, and insulin-like activity or described herein, and wherein said compound does not activate PROLIXIN.
  • the invention is directed to said compound, wherein said compound blocks or inhibits PROLLXPN expression and wherein said compound does not have LIGAND activity, said activity being selected from the group consisting of lipid partitioning, lipid metabolism, and insulin-like activity or described herein, and wherein said compound does not activate PROLIXIN.
  • the invention is directed to a PROLIXIN ANTAGONIST, wherein said ANTAGONIST is a variant or fragment of LIGAND polypeptide. More preferably the invention is directed to said variant of fragment of LIGAND polypeptide, wherein said variant or fragment of LIGAND polypeptide binds PROLLXPN and blocks LIGAND activity, said activity being selected from the group consisting of lipid partitioning, lipid metabolism, and insulin-like activity or described herein, and wherein said variant or fragment of LIGAND polypeptide does not activate PROLIXIN.
  • said variant or fragment of LIGAND polypeptide blocks or inhibits LIGAND binding to PROLIXIN. More preferably the invention is directed to said variant or fragment of LIGAND polypeptide, wherein said variant or fragment of LIGAND polypeptide inhibits the induction, enhancement, or potentiation of said biological activity exclusive of binding to PROLLXPN.
  • the invention is directed to a PROLIXIN ANTAGONIST that selectively binds to a polypeptide comprising the extracellular domain of PROLIXIN.
  • said ANTAGONIST is able to raise circulating (either blood, serum or plasma) levels (concentration) of: (i) free fatty acids, (ii) glucose, and/or
  • ANTAGONISTS are those that significantly inhibit muscle lipid or free fatty acid oxidation stimulated by its LIGAND. Further preferred said ANTAGONISTS are those that cause C2C12 cells differentiated in the presence of LIGAND to undergo at least 10%, 20%, 30%, 35%, or 40% less oleate oxidation as compared to untreated cells.
  • ANTAGONISTS are those that inhibit by at least 10%, 20%, 30%, 35%, or 40% the increase in leptin uptake stimulated by LIGAND polypeptide in a liver cell line [preferably BPRCL mouse liver cells (ATCC CRL-2217)] as compared to untreated cells.
  • ANTAGONISTS are those that significantly increase the postprandial increase in plasma free fatty acids, particularly following a high fat meal.
  • ANTAGONISTS are those that significantly increase ketone body production, particularly following a high fat meal. Further preferred said ANTAGONISTS are those that decrease glucose uptake in skeletal muscle cells stimulated by LIGAND.
  • ANTAGONISTS are those that decrease glucose uptake in adipose cells stimulated by LIGAND.
  • ANTAGONISTS are those that decrease glucose uptake in neuronal cells stimulated by LIGAND.
  • ANTAGONISTS are those that decrease glucose uptake in red blood cells stimulated by LIGAND.
  • ANTAGONISTS are those that decrease glucose uptake in the brain stimulated by LIGAND. Further preferred said ANTAGONISTS are those that significantly increase the postprandial increase in plasma glucose following a meal, particularly a high carbohydrate meal.
  • ANTAGONISTS are those that significantly facilitate the postprandial increase in plasma glucose following a meal, particularly a high fat or a high carbohydrate meal. Further preferred said ANTAGONISTS are those that reduce the insulin sensitivity stimulated by LIGAND.
  • ANTAGONISTS are those that increase body mass, wherein said increase in body mass is comprised of a change in mass of the subcutaneous adipose tissue. Further preferred said ANTAGONISTS are those that increase body mass, wherein said increase in body mass is comprised of a change in mass of the visceral (omental) adipose tissue.
  • the invention features a pharmaceutical or physiologically acceptable composition
  • a pharmaceutical or physiologically acceptable composition comprising, consisting essentially of, or consisting of, said ANTAGONIST described in the twelfth aspect and, alternatively, a pharmaceutical or physiologically acceptable diluent.
  • the invention features a method of increasing body mass comprising providing or administering to individuals in need of increasing body mass said pharmaceutical or physiologically acceptable composition described in the thirteenth aspect.
  • the invention features a method of preventing or treating disorders associated with excessive weight loss comprising providing or administering to an individual in need of such treatment said pharmaceutical or physiologically acceptable composition described in the thirteenth aspect.
  • said disorder is selected from the group consisting of cachexia, wasting, cancer-related weight loss, AJDS-related weight loss, chronic inflammatory disease-related weight loss, anorexia, and bulimia.
  • Said disorders associated with excessive weight loss are comprised of those mediated by tumor necrosis factor (TNFalpha) alone, those mediated by TNFalpha plus one or more additional factors, and those mediated only by one or more factors exclusive of TNFalpha.
  • TNFalpha tumor necrosis factor
  • Said factors include, but are not restricted to, macrophage migration inhibitory factor, interleukin 1, and interleukm 6.
  • said individual is a mammal, preferably a human.
  • embodiments of the present invention includes methods of causing or inducing a desired biological response in an individual comprising the steps of: providing or administering to an individual a composition comprising ANTAGONIST, wherein said biological response is selected from the group consisting of:
  • the present invention of said pharmaceutical or physiologically acceptable composition can be used as a method of increasing body mass in some persons with cachexia, wasting, cancer-related weight loss, AIDS- related weight loss, chronic inflammatory disease-related weight loss, anorexia, and bulimia.
  • the present invention of said pharmaceutical or physiologically acceptable composition further provides a method for the use as an insulin de- sensitiser, wherein the sensitivity of a cell or tissue to insulin is reduced.
  • the invention features a method of making the PROLLXPN polypeptide described in the twelfth aspect, wherein said method is selected from the group consisting of proteolytic cleavage, recombinant methodology and artificial synthesis, hi a preferred embodiment, proteolytic cleavage is carried out using trypsin, plasmin, or collagenase.
  • the invention features a use of ANTAGONIST described in the twelfth aspect for the preparation of a medicament for the treatment of disorders associated with excessive weight loss and/or for increasing body mass.
  • said disorder is selected from the group consisting of cachexia, wasting, cancer-related weight loss, AIDS-related weight loss, chronic inflammatory disease-related weight loss, anorexia, and bulimia.
  • said individual is a mammal, preferably a human.
  • the invention provides ANTAGONIST of the twelfth aspect of the invention, or a composition of the thirteenth aspect of the invention, for use in a method of treatment of the human or animal body.
  • the invention features methods of increasing body weight comprising providing to an individual said pharmaceutical or physiologically acceptable composition described in the thirteenth aspect, or ANTAGONIST described in the twelfth aspect.
  • the individual has a BMI of no greater than 25 and at least 20.
  • the individual may have a BMI no greater than 20.
  • One embodiment for the treatment of disorders associated with excessive weight loss provides for the treatment of individuals with BMI values of no greater than 15.
  • the BMI value should be at least 15 and no more than 20.
  • the invention features the pharmaceutical or physiologically acceptable composition described in the thirteenth aspect for increasing body mass and/or for treatment of disorders associated with excessive weight loss.
  • said disorder is selected from the group consisting of cachexia, wasting, cancer-related weight loss, AIDS-related weight loss, chronic inflammatory disease-related weight loss, anorexia, and bulimia.
  • said individual is a mammal, preferably a human.
  • the invention features the pharmaceutical or physiologically acceptable composition described in the thirteenth aspect for increasing body weight for cosmetic reasons.
  • ANTAGONIST administered to an individual is sufficient to bring levels of PROLIXIN activation to their normal levels (levels in healthy individuals).
  • "Normal levels" of PROLIXIN activation may be followed using surrogate markers including circulating (either blood, serum or plasma) levels (concentration) of: (i) free fatty acids, (ii) glucose, and/or (iii) triglycerides.
  • Table 1 lists known or predicted biologic structural and functional domains for the PROLIXIN polypeptide of SEQ ID NO:2 of the present invention, including the extracellular (EC) domain, transmembrane domain, and intracellular (IC) domain.
  • Table 2 lists the amino acid sequence of full-length APMl, C2P, ZADJ-2 and ZADJ-7 polypeptide. The total number of amino acids is given in parentheses.
  • the predicted signal peptide is indicated in bold.
  • the collagen-like region is indicated by dotted line.
  • the region between the predicted signal peptide and the collagen-like region is the N-terminally disposed unique region.
  • the globular C-terminal Clq homology domain is indicated by single underline.
  • NGLXXD amino acid motif C-terminally disposed within the globular domain is indicated by double underline. It is taken to be understood that C2P herein encompasses variants comprising the substitution of valine for methionine at position 219 and/or the substitution of methionine for valine at position 301.
  • the full-length PROLIXIN polypeptide is comprised of at least 3 distinct regions including: 1. an extracellular domain comprising a LIGAND binding portion and comprising amino acids from about amino acids 1-76 of SEQ ID NO:2;
  • transmembrane domain comprising amino acids from about amino acids 77-99 of SEQ ID NO:2;
  • an intracellular domain comprising amino acids from about amino acids 100-184 of SEQ ID NO:2.
  • SEQ ID NO:l is the nucleotide sequence of cDNA with an open reading frame which location is indicated as features. When appropriate, the locations of the potential polyadenylation site and polyadenylation signal are also indicated.
  • SEQ ID NO: 2 is the amino acid sequence of polypeptide encoded by the cDNA of SEQ ID NO:
  • isolated requires that the material be removed from its original environment (e. g., the natural environment if the material is naturally occurring).
  • the term “purified” does not require absolute purity; rather, it is intended as a relative definition. Purification of starting material or natural material to at least one order of magnitude, preferably two or three orders, and more preferably four or five orders of magnitude is expressly contemplated.
  • polynucleotide(s) include RNA or DNA (either single or double stranded, coding, complementary or antisense), or RNA/DNA hybrid sequences of more than one nucleotide in either single chain or duplex form (although each of the above species may be particularly specified).
  • complementary or “complement thereof are used herein to refer to the sequences of polynucleotides that are capable of forming Watson & Crick base pairing with another specified polynucleotide throughout the entirety of the complementary region.
  • polypeptide and "protein”, used interchangeably herein, refer to a polymer of amino acids without regard to the length of the polymer; thus, peptides, oligopeptides, and proteins are included within the definition of polypeptide. This term also does not specify or exclude chemical or post-expression modifications of the polypeptides of the invention, although chemical or post-expression modifications of these polypeptides may be included excluded as specific embodiments.
  • polynucleotide construct As used herein, the terms “recombinant polynucleotide” and “polynucleotide construct” are used interchangeably to refer to linear or circular, purified or isolated polynucleotides that have been artificially designed and which comprise at least two nucleotide sequences that are not found as contiguous nucleotide sequences in their initial natural environment. In particular, these terms mean that the polynucleotide or cDNA is adjacent to "backbone" nucleic acid to which it is not adjacent in its natural environment.
  • recombinant polypeptide is used herein to refer to polypeptides that have been artificially designed and which comprise at least two polypeptide sequences that are not found as contiguous polypeptide sequences in their initial natural environment, or to refer to polypeptides which have been expressed from a recombinant polynucleotide.
  • operably linked refers to a linkage of polynucleotide elements in a functional relationship.
  • non-human animal refers to any non-human animal, including insects, birds, rodents and more usually mammals. Both the terms “animal” and “mammal” expressly embrace human subjects unless preceded with the term “non-human”.
  • domain refers to an amino acid fragment with specific biological properties. This term encompasses all known structural and linear biological motifs.
  • receptor refers to a polypeptide to which a "ligand” binds and through which said "ligand” elicits a biological response comprised of biological activities. Said receptor is preferably PROLIXIN of the present invention. Said “ligand” is preferably LIGAND of the present invention.
  • receptor activation is intended “ligand”-mediated alteration of said receptor polypeptide, wherein said alteration is selected from but not limited to the group consisting of receptor alterations associated with said biological response.
  • AGONIST refers to naturally occurring and synthetic compounds capable of inducing, enhancing, or potentiating a biological response comprised of biological activities.
  • ANTAGONIST refers to naturally occurring and synthetic compounds capable of inhibiting a biological response, inhibiting the induction of a biological response, or inhibiting the potentiation of a biological response, wherein said biological response is comprised of biological activities.
  • the compounds/polypeptides of the invention are capable of modulating the partitioning of dietary lipids between the liver and peripheral tissues, and are thus believed to treat "diseases involving the partitioning of dietary lipids between the liver and peripheral tissues."
  • peripheral tissues is meant to include muscle and adipose tissue.
  • the compounds/polypeptides of the invention partition the dietary lipids toward or away from the muscle.
  • the dietary lipids are partitioned toward or away from the adipose tissue.
  • the dietary lipids are partitioned toward or away from the liver.
  • the compounds/polypeptides of the invention increase or decrease the oxidation of dietary lipids, preferably free fatty acids (FFA) by the muscle.
  • Dietary lipids include, but are not limited to triglycerides and free fatty acids.
  • Preferred diseases believed to involve the partitioning of dietary lipids include obesity- related diseases and disorders such as obesity, insulin resistance, atherosclerosis, atheromatous disease, heart disease, hypertension, stroke, Syndrome X, Noninsulin Dependent Diabetes Mellitus
  • NIDDM Insulin Dependent Diabetes Mellitus
  • Diabetes-related complications to be treated by the methods of the invention include microangiopathic lesions, ocular lesions, retinopathy, neuropathy, and renal lesions.
  • Heart disease includes, but is not limited to, cardiac insufficiency, coronary insufficiency, and high blood pressure.
  • Other obesity-related disorders to be treated by compounds of the invention include hyperlipidemia and hyperuricemia.
  • Yet other disorders of the invention include disorders associated with excessive weight loss such as cachexia, wasting, cancer-related weight loss, AIDS-related weight loss, chronic inflammatory disease-related weight loss, anorexia, and bulimia.
  • polypeptides of the invention are recombinantly produced using routine expression methods known in the art.
  • the polynucleotide encoding the desired polypeptide is operably linked to a promoter into an expression vector suitable for any convenient host. Both eukaryotic and prokaryotic host systems are used in forming recombinant polypeptides.
  • the polypeptide is then isolated from lysed cells or from the culture medium and purified to the extent needed for its intended use.
  • a further embodiment of the present invention is a method of making a polypeptide, said method comprising the steps of a) obtaining a cDNA encoding said polypeptide; b) inserting said cDNA in an expression vector such that the cDNA is operably linked to a promoter; and c) introducing said expression vector into a host cell whereby said host cell produces said polypeptide.
  • the method further comprises the step of isolating the polypeptide.
  • Another embodiment of the present invention is a polypeptide obtainable by the method described in the preceding paragraph.
  • the expression vector is any of the mammalian, yeast, insect or bacterial expression systems known in the art. Commercially available vectors and expression systems are available from a variety of suppliers including Genetics Institute (Cambridge, MA), Stratagene (La Jolla, California),
  • recombinant polypeptides of the invention are expressed in mammalian cells.
  • the invention is drawn, inter alia, to isolated, purified or recombinant polypeptides.
  • PROLLXFN polypeptides of the invention are useful for increasing (ANTAGONISTS of
  • PROLIXIN body weight either as a cosmetic treatment or for treatment or prevention of diseases and disorders as discussed or described herein.
  • PROLIXIN polypeptides are also useful inter alia in screening assays for AGONISTS or ANTAGONISTS of PROLLXESf activity and for raising
  • PROLLXLN-specific antibodies When used for cosmetic treatments, or for the treatment or prevention of diseases, disorders, or conditions, one or more PROLIXIN polypeptides can be provided to a subject. Thus, various fragments of the full-length protein can be combined into a
  • LIGAND polypeptides of the invention are useful for reducing (AGONISTS of PROLIXIN) body weight either as a cosmetic treatment or prevention of diseases and disorders as discussed or described herein.
  • PROLLXPN polypeptides of the present invention are preferably provided in an isolated form, and may be partially or substantially purified.
  • Modifying PROLLXPN biological activity Modifying endogenous PROLIXIN biological activity is expressly contemplated by the present invention.
  • the present invention further relates to compounds able to modulate PROLIXIN biological activity and methods to use these compounds. Such compounds may interact with PROLLXFN polypeptides directly or indirectly.
  • Candidate AGONISTS and ANTAGONISTS Obtained by Optical Biosensor Methods Compounds interacting with a polypeptide comprising PROLLXESf extracellular domain can be screened by using an Optical Biosensor as described in Edwards and Leatherbarrow (1997) and also in Szabo et al. (1995), the disclosures of which are incorporated by reference. This technique permits the detection of interactions between molecules in real time, without the need of labeled molecules. This technique, which is based on the surface plasmon resonance (SPR) phenomenon, is presented in more detail in Example 1.
  • SPR surface plasmon resonance
  • Another method of screening for compounds that modulate PROLLXFN biological activity is by measuring the effects of test compounds on specific biological activity, wherein said activity is selected from the group consisting of lipid partitioning, lipid metabolism, and insulin-like activity or as described herein, in a host cell.
  • the present invention relates to a method of identifying an agent that alters PROLIXIN activity, wherein a nucleic acid construct comprising the polynucleotide of SEQ ID NO: 1 or a fragment thereof encoding full-length PROLLXFN polypeptide is introduced into a mammalian host cell.
  • the transfected mammalian host cells are maintained under conditions appropriate for expression of the encoded PROLIXIN, whereby the nucleic acid is expressed.
  • the host cells are then contacted with a compound to be assessed (an agent) and an activity of the cells is detected in the presence of the compound to be assessed, wherein said activity is selected from the group consisting of lipid partitioning, lipid metabolism, and insulin-like activity or as described herein.
  • the invention relates to a method of identifying an agent which is an activator (AGONIST) of PROLIXIN activity, wherein detection of an increase of said activity, said activity being selected from the group consisting of lipid partitioning, lipid metabolism, and insulin-like activity or as described herein, in the presence of the agent indicates that the agent activates PROLLXPN activity.
  • AGONIST activator
  • the invention relates to a method of identifying an agent which is an inhibitor (ANTAGONIST) of PROLIXIN activity, wherein detection of a decrease of said activity, said activity being selected from the group consisting of lipid partitioning, lipid metabolism, and insulin-like activity or as described herein, in the presence of the agent indicates that the agent inhibits PROLLXPN activity.
  • an agent which is an inhibitor (ANTAGONIST) of PROLIXIN activity
  • Detection of a change in said PROLLXFN activity can be performed using a variety of techniques as described for representative activities in Examples provided herein.
  • a high throughput screen can be used to identify agents that activate (enhance) or inhibit PROLIXIN activity (See e.g., PCT publication WO 98/45438, which disclosure is hereby incorporated by reference in its entirety).
  • the present invention also relates to methods of screening compounds for their ability to modulate (e.g. increase or inhibit) the activity or expression of PROLLXFN. More specifically, the present invention relates to methods of testing compounds for their ability either to increase or to decrease activity of PROLLXFN.
  • the assays are performed in vitro or in vivo.
  • the present invention relates to a method for the screening of a candidate substance for interaction with a polypeptide comprising PROLLXFN extracellular domain, said method comprising the following steps: a) providing said polypeptide comprising PROLIXIN extracellular domain; b) obtaining a candidate substance; c) bringing into contact said polypeptide with said candidate substance; d) detecting the complexes formed between said polypeptide and said candidate substance.
  • the invention further relates to a method for the production of a pharmaceutical composition comprising a method for the screening of a candidate substance that interact with a PROLIXIN polypeptide, fragments or variants thereof and furthermore mixing the identified substance with a pharmaceutically acceptable carrier.
  • the present invention relates to a method for the screening of a candidate substance for the capacity to increase expression of PROLLXFN, said method comprising the following steps: a) isolating mRNA from cells which have or have not been contacted with said candidate substance; b) carrying out a Northern blot analysis with labeled cDNA probe encoding all or part of PROLLXFN polypeptide; c) wherein increased signal in cells having been contacted with said candidate substance over that of uncontacted cells is taken to indicate that said candidate substance increases expression of PROLLXIN and is an AGONIST of PROLLXESf activity; and d) wherein decreased signal in cells having been contacted with said candidate substance over that of uncontacted cells is taken to indicate that said candidate substance decreases expression of PROLIXIN and is an ANTAGONIST of PROLLXPN activity.
  • Substantially pure protein or polypeptide is isolated from transfected or transformed cells containing an expression vector encoding the PROLLXFN protein or a portion thereof.
  • concentration of protein in the final preparation is adjusted, for example, by concentration on an Amicon filter device, to the level of a few micrograms/ml.
  • Monoclonal or polyclonal antibody to the protein can then be prepared by methods well known to those of ordinary skill in the art.
  • the present invention includes monoclonal and polyclonal antibodies that specifically bind PROLIXIN polypeptide fragment comprising the extracellular domain of mature
  • PROLLXESf polypeptide comprises amino acids 1-39, 2-39, 1-42, 2-42, 1-44, 2-44, 1-51, 2-51, 1-54, 2-54, 1-58, 2-58, 1-63, 2-63, 1-67, 2-67,
  • EXAMPLE 1 Use of Biacore Technology to Detect Specific Binding of a Test Compound to Polypeptide Fragment Comprising PROLLXFN Extracellular Domain
  • Biacore utilizes a biosensor technology for monitoring interactions between two or more molecules in real time, without the use of labels.
  • the molecular classes than can be studied are diverse, ranging from proteins, peptides, nucleic acids, carbohydrates, and lipids to low molecular weight substances and pharmaceuticals.
  • the detection principle is based on the optical phenomena of surface plasmon resonance, which detects changes in refractive index close to a biosensor surface.
  • one of the interacting molecules is immobilized or captured (here, polypeptide fragment comprising PROLLXFN extracellular domain) to a flexible dextran layer close to the sensor surface.
  • the interacting partner here, test compound
  • Soluble polypeptide fragment comprising PROLLXFN extracellular domain is attached to the sensor surface via amine coupling chemistry.
  • the dextran is activated using N-hydroxysuccinimide and N-ethyl-N'-(3-dimethylaminopropyl)-carbodiimide hydrochloride for 7 minutes.
  • Said PROLLXPN polypeptide fragment is diluted in lOmM Na Acetate pH 5.0 at a concentration of lO ⁇ g/ml and injected over the activated surface for 7 minutes. The surface is then blocked for 7 minutes using ethanolamine to remove any remaining esters.
  • a blank flow cell absent said PROLLXESf polypeptide fragment is set up in parallel and used as a control surface.
  • the running buffer is HBS-EP (0.01M HEPES pH 7.4, 0.15M NaCl, 3mM EDTA, 0.005% Surfactant P20) and the instrument temperature is 25°C.
  • test compound is filtered through an Ultrafree-0.5 Centrifugal Filter Device and resuspended in HBS-EP running buffer.
  • the test compound is then diluted 1:10 in HBS-EP and injected over the said PROLLXPN polypeptide fragment surface and the blank control surface for 1 minute at a flow rate of 50 ⁇ l/min.
  • the sensorgrams from the receptor surface and the control surface are aligned and overlayed.
  • control surface was subtracted from the active surface comprised of said PROLLXPN polypeptide fragment.
  • C2C12 cells are differentiated in the presence or absence of 2 ⁇ g/mL LIGAND for 4 days.
  • oleate oxidation rates are determined by measuring conversion of l- 14 C-oleate (0.2 mM) to 14 C0 2 for 90 min. This experiment can be used to screen for active polypeptides and peptides as well as AGONISTS and ANTAGONISTS or activators and inhibitors of LIGAND receptor.
  • C2C12 cells murine skeletal muscle cells; ATCC, Manassas, VA CRL-1772
  • hepatocytes a hepatocyte
  • DMEM low serum differentiation media
  • EXAMPLE 3 Effect of LIGAND on In Vitro Glucose Uptake by Muscle Cells
  • L6 Muscle cells are obtained from the European Culture Collection (Porton Down) and are used at passages 7-11. Cells are maintained in standard tissue culture medium DMEM, and glucose
  • Uptake of 2DG is expressed as the percentage change compared with control (no added insulin orLIGAND). Values are presented as mean ⁇ SEM of sets of 4 wells per experiment. Differences between sets of wells are evaluated by Student's t test, probability values p ⁇ 0.05 are considered to be significant.
  • mice Experiments are performed using approximately 6 week old C57B1/6 mice (8 per group). All mice are housed individually. The mice are maintained on a high fat diet throughout each experiment.
  • the high fat diet (cafeteria diet; D 12331 from Research Diets, Inc.) has the following composition: protein kcal% 16, sucrose kcal% 26, and fat kcal% 58.
  • the fat is primarily composed 35 of coconut oil, hydrogenated.
  • mice After the mice are fed a high fat diet for 6 days, micro-osmotic pumps are inserted using isoflurane anesthesia, and are used to provide LIGAND, saline, and an irrelevant peptide to the mice subcutaneously (s.c.) for 18 days.
  • LIGAND is provided at doses of 100, 50, 25, and 2.5 ⁇ g/day and the irrelevant peptide is provided at 10 ⁇ g/day.
  • Body weight is measured on the first, third and fifth day of the high fat diet, and then daily after the start of treatment. Final blood samples are taken by cardiac puncture and are used to determine triglyceride (TG), total cholesterol (TC), glucose, leptin, and insulin levels. The amount of food consumed per day is also determined for each group.
  • TG triglyceride
  • TC total cholesterol
  • glucose leptin
  • insulin levels The amount of food consumed per day is also determined for each group.
  • mice used in this experiment are fasted for 2 hours prior to the experiment after which a baseline blood sample is taken. All blood samples are taken from the tail using EDTA coated capillary tubes (50 ⁇ L each time point).
  • EDTA coated capillary tubes 50 ⁇ L each time point.
  • time 0 8:30 AM
  • a standard high fat meal (6g butter, 6 g sunflower oil, 10 g nonfat dry milk, 10 g sucrose, 12 mL distilled water prepared fresh following
  • a LIGAND is injected i.p. in 100 ⁇ L saline.
  • Plasma samples are taken in hourly intervals, and are immediately put on ice. Plasma is prepared by centrifugation following each time point. Plasma is kept at -20°C and free fatty acids
  • FFA triglycerides
  • TG triglycerides
  • glucose is determined within 24 hours using standard test kits (Sigma and Wako). Due to the limited amount of plasma available, glucose is determined in duplicate using pooled samples. For each time point, equal volumes of plasma from all 8 animals per treatment group are pooled.
  • EXAMPLE 6 Effect of LIGAND on Plasma FFA. TG and Glucose in C57 BL/6 Mice
  • Plasma samples are immediately put on ice. Plasma is prepared by centrifugation following each time point. Plasma is kept at -20 °C and free fatty acids (FFA), triglycerides (TG) and glucose are determined within 24 hours using standard test kits (Sigma and Wako).
  • FFA free fatty acids
  • TG triglycerides
  • glucose are determined within 24 hours using standard test kits (Sigma and Wako).
  • EXAMPLE 7 Effect of LIGAND on FFA following Epinephrine Injection
  • mice plasma free fatty acids increase after intragastric administration of a high fat/sucrose test meal. These free fatty acids are mostly produced by the activity of lipolytic enzymes i.e. lipoprotein lipase (LPL) and hepatic lipase (HL). In this species, these enzymes are found in significant amounts both bound to endothelium and freely circulating in plasma.
  • lipolytic enzymes i.e. lipoprotein lipase (LPL) and hepatic lipase (HL).
  • LPL lipoprotein lipase
  • HL hepatic lipase
  • Another source of plasma free fatty acids is hormone sensitive lipase (HSL) that releases free fatty acids from adipose tissue after ⁇ -adrenergic stimulation.
  • HSL hormone sensitive lipase
  • mice are injected with epinephrine.
  • mice Two groups of mice are given epinephrine (5 ⁇ g) by intraperitoneal injection.
  • a treated group is injected with a LIGAND (25 ⁇ g) one hour before and again together with epinephrine, while control animals receive saline.
  • Plasma is isolated and free fatty acids and glucose are measured.
  • EXAMPLE 8 Effect of LIGAND on FFA following Intralipid Injection Two groups of mice are intravenously (tail vein) injected with 30 ⁇ L bolus of h tralipid-20%
  • LIGAND intravenous fat emulsion used in nutritional therapy
  • a treated group (LIGAND-treated) is injected with LIGAND (25 ⁇ g) at 30 and 60 minutes before Intralipid is given, while control animals receive saline. Plasma is isolated and FFAs are measured as described previously. The effect of LIGAND on the decay in plasma FFAs following the peak induced by Intralipid inj ection is then monitored.
  • EXAMPLE 9 Effect of LIGAND on Weight Gain and Weight Loss of Mice and on Maintenance of Weight Loss in Mice i the first experiment, 10-week-old male C57BL/6J mice are put on a very high fat/sucrose purified diet for 19 days to promote weight gain; the average body weight at this time is 30g. The mice are then surgically implanted with an osmotic pump (Alzet, Newark, DE) delivering either 2.5 ⁇ g/day of LIGAND or physiological saline. The mice are continued on the high fat diet and their body weight was recorded over the following 10-day period.
  • an osmotic pump Alzet, Newark, DE
  • mice are put on a reduced calorie diet to promote weight loss.
  • the reduced calorie diet is continued until the mice lose 10% of their initial weight.
  • a second group of mice are continued on the reduced calorie diet until the mice lose 20%> of their initial weight.
  • the mice are then surgically implanted with an osmotic pump (Alzet, Newark, DE) delivering either 2.5 ⁇ g/day of LIGAND or physiological saline.
  • the mice are returned to a normal diet and their body weights are recorded over a 10-day period. After 10 days, the outcome wherein mice treated with LIGAND have a lower weight than mice treated with saline is taken to provide evidence that treatment with LIGAND promotes the maintenance of weight loss.
  • EXAMPLE 10 Assessment of homotrimer formation by gAPMl, gC2P. gZADJ-2 or gZADJ-7 polypeptide fragment.
  • Homotrimer formation by gAPMl, gC2P, gZADJ-2 or gZADJ-7 polypeptide fragment is assessed using sedimentation equilibrium in analytical centrifuges, a method that determines molecular weight accurately and independently of other physical factors such as shape.
  • Candidate gAPMl, gC2P, gZADJ-2 or gZADJ-7 polypeptide fragment homotrimer is purified, for example using a protocol comprising a method of gel filtration such as 16/60 superdex 200 gel filtration column (Amersham).
  • Said purified candidate gAPMl, gC2P, gZADJ-2 or gZADJ- 7 polypeptide fragment homotrimer protein concentration is made 3 ⁇ M in 5.7 mM phosphate (pH 7.5), 137 mM NaCl, 2.7 mM KC1. Samples are centrifuged at 8,000 rpm for 18 hours at 10°C in a Beckman XL-A analytical ultracentrifuge before absorbance is recorded.
  • Abs B +A'exp[H x M (x 2 -Xo 2 ]
  • Abs absorbance at radius x
  • A' absorbance at reference radius x 0
  • H (l-vp) ⁇ 2 /2RT
  • R gas constant
  • T temperature in Kelvin
  • angular velocity in radians/s
  • M apparent molecular weight
  • B solvent absorbance (blank).
  • EC extracellular domain
  • IC intracellular domain

Abstract

The present invention relates to the field of metabolic research, in particular the discovery of compounds effective for reducing body mass and useful for treating obesity-related diseases and disorders. The obesity-related diseases or disorders envisioned to be treated by the methods of the invention include, but are not limited to, hyperlipidemia, atherosclerosis, insulin resistance, diabetes, and hypertension. In particular, the invention provides for methods of identifying and using AGONISTS and ANTAGONISTS of PROLIXIN activity, wherein said activity is selected from the group consisting of lipid partitioning, lipid metabolism, and insulin-like activity.

Description

AGONISTS AND ANTAGONISTS OF PROLIXIN FOR THE TREATMENT OF METABOLIC DISORDERS
Field of the Invention
5 The present invention relates to the field of metabolic research, in particular the discovery of compounds effective for reducing body mass and maintaining weight loss and useful for treating obesity-related diseases and disorders. The obesity-related diseases or disorders envisioned to be treated by the methods of the invention include, but are not limited to, hyperlipidemia, atherosclerosis, insulin resistance, diabetes, and hypertension. The present invention additionally 0 relates elsewhere to the field of metabolic research, in particular the discovery of compounds effective for increasing body mass and useful for treating disorders associated with excessive weight loss. Applicant reserves the right to exclude any of the aforesaid obesity-related diseases or disorders. The disorders associated with excessive weight loss and envisioned to be treated by the methods of the invention include, but are not limited to, cachexia, cancer-related weight loss, ATDS- 5 related weight loss, chronic inflammatory disease-related weight loss, and anorexia. Applicant reserves the right to exclude any of the aforesaid disorders associated with excessive weight loss.
In particular, the invention provides for methods of identifying and using AGONISTS and ANTAGONISTS of PROLIXIN activity, wherein said activity is selected from the group consisting of lipid partitioning, lipid metabolism, and insulin-like activity. 0 Background of the Invention
The following discussion is intended to facilitate the understanding of the invention, but is not intended nor admitted to be prior art to the invention.
Obesity is a public health problem that is serious, widespread, and increasing. In the United States, 20 percent of the population is obese; in Europe, a slightly lower percentage is obese 5 (Friedman (2000) Nature 404:632-634). Obesity is associated with increased risk of hypertension, cardiovascular disease, diabetes, and cancer as well as respiratory complications and osteoarthritis (Kopelman (2000) Nature 404:635-643). Even modest weight loss ameliorates these associated conditions.
Recently it was shown that particular carboxyl-terminal fragments of the full-length 0 ACRP30 (mouse) and APMl (human) polypeptides have unexpected effects in vitro and in vivo, including utility for weight reduction, prevention of weight gain, and control of blood glucose levels (Fruebis et al (2001) Proc Natl Acad Sci USA 98:2005-10). The effects of ACRP30 fragment administration in mammals also include reduction of elevated free fatty acid levels including elevated free fatty acid levels caused by administration of eprnephrine, i.v. injection of "intralipid", or administration of a high fat test meal, as well as increased fatty acid oxidation in muscle cells, and weight reduction in mammals consuming a normal or high fat/high sucrose diet.
Throughout this application, various publications, patents and published patent applications are cited. The disclosures of these publications, patents and published patent specification referenced in this application are hereby incorporated by reference into the present disclosure to more fully describe the state of the art to which this invention pertains.
Summary of the Invention
APMl belongs to an expanding family of related secreted polypeptides that includes among others C2P, ZADJ-2 and ZADJ-7. These polypeptides have in common the structure: signal peptide, N-terminally disposed unique region, collagen-like region, and globular C-terminal Clq homology domain. APMl, C2P, ZADJ-2 and ZADJ-7 further share an NGLXXD amino acid motif C-terminally disposed within the globular domain within a loop implicated in receptor binding, wherein said receptor is PROLIXIN. Fragments of APMl, C2P, ZADJ-2 and ZADJ-7 polypeptide comprising the globular domain are herein referred to as gAPMl, gC2P, gZADJ-2 and gZADJ-7. It is further taken to be understood herein that LIGAND refers to a composition consisting essentially of or consisting of in vitro or in vivo self-assembling homotrimer comprised of gAPMl, gC2P, gZADJ-2, or gZADJ-7 polypeptide fragment.
PROLIXIN is a member of the Tumor Necrosis Factor Receptor Super Family (TNFRSF) and is a Type Ul transmembrane protein. The instant invention is based on PROLLXIN as receptor for LIGAND that mediates effects, including utility for weight reduction, maintenance of weight loss, prevention of weight gain, increased insulin sensitivity, and control of blood glucose levels in humans and other mammals. These effects in mammals of PROLIXIN engagement by LIGAND also include reduction of elevated free fatty acid levels including elevated free fatty acid levels including elevated free fatty acid levels caused by administration of epinephrine, i.v. injection of "intralipid", or administration of a high fat test meal, as well as increased fatty acid oxidation in muscle cells, and weight reduction in mammals consuming a normal or high fat/high sucrose diet. More specifically, the present invention is directed to PROLIXIN to which LIGAND binds and through which LIGAND mediates said effects.
In particular, the invention provides for methods of identifying and using AGONISTS and ANTAGONISTS of PROLIXIN activity, wherein said activity is selected from the group consisting of lipid partitioning, lipid metabolism, and insulin-like activity, as well as to pharmaceutical and physiologically acceptable compositions comprising said PROLLXIN AGONISTS or ANTAGONISTS and methods of administering said pharmaceutical and physiologically acceptable compositions in order to increase or reduce body weight, maintain weight loss, or to treat obesity- related diseases and disorders. Assays for identifying AGONISTS and ANTAGONISTS of obesity- related activity are also part of the invention. Preferably said PROLIXIN AGONIST or ANTAGONIST is a compound selected from the group consisting of polypeptide, polypeptide fragment, peptide, proein, antibody, carbohydrate, lipid, small molecular weight organic compound and small molecular weight inorganic compound.
Preferably said PROLIXIN AGONIST or ANTAGONIST is a compound that selectively binds to the extracellular domain of PROLIXIN.
In other embodiment, said PROLIXIN AGONIST or ANTAGONIST is a compound that selectively binds to the intracellular domain of a polypeptide comprising the extracellular domain of PROLIXIN.
The present invention also provides a method of assaying test compounds to identify a test compound that binds to PROLIXIN polypeptide. The method comprises contacting PROLIXIN polypeptide with a test compound and to determine the extent of binding of the test compound to said PROLLXIN polypeptide. The method further comprises determining whether such test compounds are AGONISTS or ANTAGONISTS of PROLIXIN polypeptide. The present invention further provides a method of testing the impact of molecules on the expression of PROLLXIN polypeptide or on the activity of PROLLXIN polypeptide .
The present invention also relates to diagnostic methods of identifying individuals or non- human animals having elevated or reduced levels of PROLLXIN products, which individuals are likely to benefit from therapies to suppress or enhance PROLIXIN expression, respectively, and to methods of identifying individuals or non-human animals at increased risk for developing, or present state of having, certain diseases/disorders associated with PROLLXIN abnormal expression or biological activity.
The present invention provides for methods of identifying AGONISTS of PROLLXIN polypeptide biological activity comprising contacting a small molecule compound with PROLLXIN polypeptides and measuring PROLLXF polypeptide biological activity in the presence and absence of these small molecules. The present invention further provides for methods of identifying ANTAGONISTS of PROLIXIN polypeptide biological activity comprising contacting a small molecule compound with PROLIXIN polypeptides and measuring PROLLXIN polypeptide biological activity in the presence and absence of these small molecules. These small molecules can be a naturally occurring medicinal compound or derived from combinatorial chemical libraries. The present invention also relates to pharmaceutical or physiologically acceptable compositions comprising, an active agent, including AGONIST or ANTAGONIST of the present invention.
In a first aspect, the invention is directed to PROLIXIN AGONISTS, wherein said AGONIST is an antibody that specifically binds PROLIXIN, a compound excluding said PROLIXIN antibody (e.g., small organic or inorganic compound, protein, peptide, carbohydrate, lipid), or a LIGAND polypeptide or fragment thereof.
In a further preferred embodiment, the invention is directed to a PROLLXIN AGONIST, wherein said AGONIST is an antibody that specifically binds PROLIXIN. More preferably the invention is directed to said PROLLXIN antibody, wherein said PROLLXIN antibody binds
PROLIXIN and manifests LIGAND activity, wherein said activity is selected from the group consisting of lipid partitioning, lipid metabolism, and insulin-like activity or described herein.
In a further preferred embodiment, the invention is directed to a PROLIXIN AGONIST, wherein said AGONIST is a compound excluding said PROLLXIN antibody. More preferably the invention is directed to said compound, wherein said compound binds PROLIXIN and manifests LIGAND activity, wherein said activity is selected from the group consisting of lipid partitioning, lipid metabolism, and insulin-like activity or described herein. Further more preferably the invention is directed to said compound, wherein said compound manifests LIGAND activity exclusive of binding to PROLIXIN, wherein said activity is selected from the group consisting of lipid partitioning, lipid metabolism, and insulin-like activity or described herein. Further more preferably the invention is directed to said compound, wherein said compound increases PROLLXIN expression.
In a further preferred embodiment, the invention is directed to a PROLIXIN AGONIST that selectively binds to a polypeptide comprising the extracellular domain of PROLLXIN. hi a further preferred embodiment, the invention is directed to a PROLLXIN AGONIST, wherein said AGONIST is LIGAND, and wherein it is understood that LIGAND refers to a composition consisting essentially of or consisting of in vitro or in vivo self-assembling homotrimer comprised of gAPMl, gC2P, gZADJ-2, or gZADJ-7 polypeptide fragment. More preferably the invention is directed to said LIGAND, wherein said LIGAND binds PROLIXIN and elicits biological activity, wherein said activity is selected from the group consisting of lipid partitioning, lipid metabolism, and insulin-like activity or described herein. More preferably the invention is directed to said LIGAND, wherein said LIGAND induces, enhances, or potentiates said biological activity exclusive of binding to PROLLXIN. In preferred embodiment, said homotrimer is comprised of preferred gAPMl, gC2P, gZADJ-2 or gZADJ-7 polypeptide fragment. APMl. Preferred gAPMl polypeptide fragment is selected from amino acids 18-244, 34-
244, 49-244, 56-244, 59-244, 66-244, 69-244, 78-244, 85-244, 93-244, 101-244, 102-244, 103-244, 104-244, 107-244, 110-244 or 113-244, wherein said numbering of said amino acids within APMl amino acid sequence is understood to be taken from said APMl amino acid sequence presented in Table 2. Less preferred gAPMl fragments are indicated in bold. C2P. Preferred gC2P polypeptide fragment is selected from amino acids 20-333, 25-333,
43-333, 45-333, 46-333, 50-333, 53-333, 61-333, 67-333, 74-333, 75-333, 77-333, 81-333, 82-333, 86-333, 89-333, 95-333, 100-333, 104-333, 113-333, 116-333, 125-333, 128-333, 140-333, 160-333,
164-333, 179-333, 182-333, 185-333, 188-333, 191-333, 193-333, or 202-333, wherein said numbering of said amino acids within C2P amino acid sequence is understood to be taken from said
C2P amino acid sequence presented in Table 2. Less preferred gC2P fragments are indicated in
5 bold.
ZADJ-2. Preferred gZADJ-2 polypeptide fragment is selected from amino acids 16-285, 25- 285, 26-285, 29-285, 30-285, 91-285, 93-285, 97-285, 98-285, 99-285, 105-285, 109-285, 112-285, 120-285, 126-285, 127-285, 130-285, 132-285, 133-285, 134-285, or 150-285, wherein said numbering of said amino acids within ZADJ-2 amino acid sequence is understood to be taken from 10 said ZADJ-2 amino acid sequence presented in Table 2. Less preferred gZADJ-2 fragments are indicated in bold.
ZADJ-7. Preferred gZADJ-7 polypeptide fragment is selected from amino acids 31-303, 39-
303, 78-303, 81-303, 84-303, 85-303, 88-303, 91-303, 97-303, 99-303, 109-303, 117-303, 118-303,
127-303, 139-303, 142-303, 155-303, or 162-303, wherein said numbering of said amino acids
15 within ZADJ-7 amino acid sequence is understood to be taken from said ZADJ-7 amino acid sequence presented in Table 2. Less preferred gZADJ-7 fragments are indicated in bold.
More preferred LIGAND is APMl. hi a further preferred embodiment, said AGONIST is able to lower circulating (either blood, serum or plasma) levels (concentration) of: (i) free fatty acids, (ii) glucose, and/or (iii) triglycerides.
20 Further preferred AGONISTS are those that significantly stimulate muscle lipid or free fatty acid oxidation as compared to untreated cells. Further preferred AGONISTS are those that cause C2C12 cells differentiated in the presence of said AGONISTS to undergo at least 10%, 20%, 30%, 35%, or 40% more oleate oxidation as compared to untreated cells.
Further preferred AGONISTS are those that increase by at least 10%, 20%, 30%, 35%, or 25 40% leptin uptake in a liver cell line [preferably BPRCL mouse liver cells (ATCC CRL-2217)] as compared to untreated cells.
Further preferred AGONISTS are those that significantly reduce the postprandial increase in plasma free fatty acids or triglycerides, particularly following a high fat meal.
Further preferred AGONISTS are those that significantly reduce or eliminate ketone body 30 production, particularly following a high fat meal.
Further preferred AGONISTS are those that increase glucose uptake in skeletal muscle cells.
Further preferred AGONISTS are those that increase glucose uptake in adipose cells.
Further preferred AGONISTS are those that increase glucose uptake in neuronal cells.
Further preferred AGONISTS are those that increase glucose uptake in red blood cells. Further preferred AGONISTS are those that increase glucose uptake in the brain.
Further preferred AGONISTS are those that significantly reduce the postprandial increase in plasma glucose following a meal, particularly a high carbohydrate meal.
Further preferred AGONISTS are those that significantly prevent the postprandial increase in plasma glucose following a meal, particularly a high fat or a high carbohydrate meal.
Further preferred AGONISTS are those that improve insulin sensitivity.
Further preferred said AGONISTS are those that decrease body mass, wherein said decrease in body mass is comprised of a change in mass of the subcutaneous adipose tissue.
Further preferred said AGONISTS are those that decrease body mass, wherein said decrease in body mass is comprised of a change in mass of the visceral (omental) adipose tissue.
In a second aspect, the invention features a pharmaceutical or physiologically acceptable composition comprising, consisting essentially of, or consisting of, said AGONIST described in the first aspect and, alternatively, a pharmaceutical or physiologically acceptable diluent.
In a third aspect, the invention features a method of reducing body mass comprising providing or administering to individuals in need of reducing body mass said pharmaceutical or physiologically acceptable composition described in the second aspect.
In a fourth aspect, the invention features a method of preventing or treating an obesity- related disease or disorder comprising providing or administering to an individual in need of such treatment said pharmaceutical or physiologically acceptable composition described in the second aspect. Preferably, said obesity-related disease or disorder is selected from the group consisting of obesity, insulin resistance, atherosclerosis, atheromatous disease, heart disease, hypertension, stroke, Syndrome X, Noninsulin Dependent Diabetes Mellitus (NIDDM, or Type II diabetes) and Insulin Dependent Diabetes Mellitus (IDDM or Type I diabetes). Diabetes-related complications to be treated by the methods of the invention include microangiopathic lesions, ocular lesions, retinopathy, neuropathy, and renal lesions. Heart disease includes, but is not limited to, cardiac insufficiency, coronary insufficiency, and high blood pressure. Other obesity-related disorders to be treated by said PROLLXIN AGONIST of the invention include hyperlipidemia and hyperuricemia. In preferred embodiments, said individual is a mammal, preferably a human.
In related aspects, embodiments of the present invention includes methods of causing or inducing a desired biological response in an individual comprising the steps of: providing or administering to an individual a composition comprising AGONIST, wherein said biological response is selected from the group consisting of:
(a) lowering circulating (either blood, serum, or plasma) levels (concentration) of free fatty acids; (b) lowering circulating (either blood, serum or plasma) levels (concentration) of glucose;
(c) lowering circulating (either blood, serum or plasma) levels (concentration) of triglycerides; (d) stimulating muscle lipid or free fatty acid oxidation;
(c) increasing leptin uptake in the liver or liver cells;
(e) reducing the postprandial increase in plasma free fatty acids, particularly following a high fat meal;
(f) reducing or eliminating ketone body production, particularly following a high fat meal;
(g) increasing tissue sensitivity to insulin, particularly muscle, adipose, liver or brain, and further wherein said biological response is significantly greater than, or at least 10%, 20%, 30% , 35%, or 40% greater than that observed in the absence of treatment; or alternatively wherein said biological response is greater than a transient response; or alternatively wherein said biological response is sustained. In further preferred embodiments, the present invention of said pharmaceutical or physiologically acceptable composition can be used as a method to control blood glucose in some persons with Noninsulin Dependent Diabetes Mellitus (NTDDM, Type II diabetes) in combination with insulin therapy.
In further preferred embodiments, the present invention of said pharmaceutical or physiologically acceptable composition can be used as a method to control blood glucose in some persons with Insulin Dependent Diabetes Mellitus (IDDM, Type I diabetes) in combination with insulin therapy.
In further preferred embodiments, the present invention of said pharmaceutical or physiologically acceptable composition can be used as a method to control body weight in some persons with Noninsulin Dependent Diabetes Mellitus (NIDDM, Type II diabetes) in combination with insulin therapy.
In further preferred embodiments, the present invention of said pharmaceutical or physiologically acceptable composition can be used as a method to control body weight in some persons with Insulin Dependent Diabetes Mellitus (IDDM, Type I diabetes) in combination with insulin therapy.
In further preferred embodiments, the present invention of said pharmaceutical or physiologically acceptable composition can be used as a method to control blood glucose in some persons with Noninsulin Dependent Diabetes Mellitus (NIDDM, Type II diabetes) alone, without combination of insulin therapy. In further preferred embodiments, the present invention of said pharmaceutical or physiologically acceptable composition can be used as a method to control blood glucose in some persons with Insulin Dependent Diabetes Mellitus (IDDM, Type I diabetes) alone, without combination of insulin therapy. In further preferred embodiments, the present invention of said pharmaceutical or physiologically acceptable composition can be used as a method to control body weight in some persons with Noninsulin Dependent Diabetes Mellitus (NIDDM, Type II diabetes) alone, without combination of insulin therapy.
In further preferred embodiments, the present invention of said pharmaceutical or physiologically acceptable composition can be used as a method to control body weight in some persons with Insulin Dependent Diabetes Mellitus (IDDM, Type I diabetes) alone, without combination of insulin therapy.
In a further preferred embodiment, the present invention may be used in complementary therapy of NEDDM patients to improve their weight or glucose control in combination with an insulin secretagogue or an insulin sensitising agent. Preferably, the insulin secretagogue is 1,1- dimethyl-2-(2-mo holino phenyl)guanidine fumarate (BTS67582) or a sulphonylurea selected from tolbutamide, tolazamide, chlorpropamide, glibenclamide, glimepiride, glipizide and glidazide. Preferably, the insulin sensitising agent is selected from metformin, ciglitazone, troglitazone and pioglitazone. The present invention further provides a method of improving the body weight or glucose control of NTDDM patients alone, without an insulin secretagogue or an insulin sensitising agent.
In a further preferred embodiment, the present invention may be used in complementary therapy of IDDM patients to improve their weight or glucose control in combination with an insulin secretagogue or an insulin sensitising agent. Preferably, the insulin secretagogue is l,l-dimethyl-2- (2-morpholino phenyl) guanidine fumarate (BTS67582) or a sulphonylurea selected from tolbutamide, tolazamide, chloφropamide, glibenclamide, glimepiride, glipizide and glidazide. Preferably, the insulin sensitising agent is selected from metformin, ciglitazone, troglitazone and pioglitazone.
The present invention further provides a method of improving the body weight or glucose control of IDDM patients alone, without an insulin secretagogue or an insulin sensitising agent.
In a further preferred embodiment, the present invention may be administered either concomitantly or concurrently, with the insulin secretagogue or insulin sensitising agent for example in the form of separate dosage units to be used simultaneously, separately or sequentially (either before or after the secretagogue or either before or after the sensitising agent). Accordingly, the present invention further provides for a composition of pharmaceutical or physiologically acceptable composition and an insulin secretagogue or insulin sensitising agent as a combined preparation for simultaneous, separate or sequential use for the improvement of body weight or glucose control in NIDDM or IDDM patients.
In further preferred embodiments, the present invention of said pharmaceutical or physiologically acceptable composition further provides a method for the use as an insulin sensitiser.
In further preferred embodiments, the present invention of said pharmaceutical or physiologically acceptable composition can be used as a method to improve insulin sensitivity in some persons with Noninsulin Dependent Diabetes Mellitus (NIDDM, Type II diabetes) in combination with insulin therapy. In further preferred embodiments, the present invention of said pharmaceutical or physiologically acceptable composition can be used as a method to improve insulin sensitivity in some persons with Insulin Dependent Diabetes Mellitus (IDDM, Type I diabetes) in combination with insulin therapy.
In further preferred embodiments, the present invention of said pharmaceutical or physiologically acceptable composition can be used as a method to improve insulin sensitivity in some persons with Noninsulin Dependent Diabetes Mellitus (NIDDM, Type II diabetes) without insulin therapy.
In a fifth aspect, the invention features a use of AGONIST described in the first aspect for treatment of obesity-related diseases and disorders and/or reducing body mass. Preferably, said obesity-related diseases and disorders are selected from the group consisting of obesity, insulin resistance, atherosclerosis, atheromatous disease, heart disease, hypertension, stroke, Syndrome X, Noninsulin Dependent Diabetes Mellitus (NIDDM, or Type II diabetes) and Insulin Dependent Diabetes Mellitus (IDDM or Type I diabetes). Diabetes-related complications to be treated by the methods of the invention include microangiopathic lesions, ocular lesions, retinopathy, neuropathy, and renal lesions. Heart disease includes, but is not limited to, cardiac insufficiency, coronary insufficiency, and high blood pressure. Other obesity-related disorders to be treated by said AGONIST of the invention include hyperlipidemia and hyperuricemia.
In a sixth aspect, the invention features a use of AGONIST described in the first aspect for the preparation of a medicament for the treatment of obesity-related diseases and disorders and/or for reducing body mass. Preferably, said obesity-related disease or disorder is selected from the group consisting of obesity, insulin resistance, atherosclerosis, atheromatous disease, heart disease, hypertension, stroke, Syndrome X, Noninsulin Dependent Diabetes Mellitus (NIDDM, or Type II diabetes) and Insulin Dependent Diabetes Mellitus (IDDM or Type I diabetes). Diabetes-related complications to be treated by the methods of the invention include microangiopathic lesions, ocular lesions, retinopathy, neuropathy, and renal lesions. Heart disease includes, but is not limited to, cardiac insufficiency, coronary insufficiency, and high blood pressure. Other obesity-related disorders to be treated by compounds of the invention include hyperlipidemia and hyperuricemia. In preferred embodiments, said individual is a mammal, preferably a human.
In a seventh aspect, the invention provides AGONIST of the first aspect of the invention, or a composition of the second aspect of the invention, for use in a method of treatment of the human or animal body.
In an eighth aspect, the invention features methods of reducing body weight comprising providing to an individual said pharmaceutical or physiologically acceptable composition described in the second aspect, or AGONIST described in the first aspect. Where the reduction of body weight is practiced for cosmetic purposes, the individual has a BMI of at least 20 and no more than 25. In embodiments for the treatment of obesity, the individual may have a BMI of at least 20. One embodiment for the treatment of obesity provides for the treatment of individuals with BMI values of at least 25. Another embodiment for the treatment of obesity provides for the treatment of individuals with BMI values of at least 30. Yet another embodiment provides for the treatment of individuals with BMI values of at least 40. In further embodiment, the invention features methods of maintaining weight loss comprising providing to an individual said pharmaceutical or physiologically acceptable composition. h a ninth aspect, the invention features the pharmaceutical or physiologically acceptable composition described in the second aspect for reducing body mass and/or for treatment or prevention of obesity-related diseases or disorders. Preferably, said obesity-related disease or disorder is selected from the group consisting of obesity, insulin resistance, atherosclerosis, atheromatous disease, heart disease, hypertension, stroke, Syndrome X, Noninsulin Dependent Diabetes Mellitus (NIDDM, or Type II diabetes) and Insulin Dependent Diabetes Mellitus (IDDM or Type I diabetes). Diabetes-related complications to be treated by the methods of the invention include microangiopathic lesions, ocular lesions, retinopathy, neuropathy, and renal lesions. Heart disease includes, but is not limited to, cardiac insufficiency, coronary insufficiency, and high blood pressure. Other obesity-related disorders to be treated by compounds of the invention include hyperlipidemia and hyperuricemia. In preferred embodiments, said individual is a mammal, preferably a human, hi preferred embodiments, the identification of said individuals to be treated with said pharmaceutical or physiologically acceptable composition comprises genotyping LIGAND single nucleotide polymorphisms (SNPs) or measuring LIGAND polypeptide or mRNA levels in clinical samples from said individuals. Preferably, said clinical samples are selected from the group consisting of blood, serum, plasma, urine, and saliva.
In a tenth aspect, the invention features the pharmaceutical or physiologically acceptable composition described in the second aspect for reducing body weight for cosmetic reasons. h an eleventh aspect, AGONIST of the invention is used in methods of treating insulin resistance comprising providing to an individual said pharmaceutical or physiologically acceptable composition described in the second aspect, or AGONIST described in the first aspect.
In a preferred aspect of the methods above and disclosed herein, the amount of AGONIST administered to an individual is sufficient to bring levels of PROLIXIN activation to their normal levels (levels in individuals without obesity-related disease or disorder). "Normal levels" of
PROLIXIN activation may be followed using surrogate markers including circulating (either blood, serum or plasma) levels (concentration) of: (i) free fatty acids, (ii) glucose, and/or (iii) triglycerides. hi a twelfth aspect, the invention is directed to a PROLIXIN ANTAGONIST, wherein said ANTAGONIST is a soluble fragment of PROLLXIN polypeptide, an antibody that specifically binds
PROLLXIN, a compound excluding said soluble fragment of PROLIXIN polypeptide and said
PROLLXIN antibody (e.g., small molecular weight organic or inorganic compound, protein, peptide, carbohydrate, lipid), or a variant or fragment of LIGAND polypeptide.
In a further preferred embodiment, the invention is directed to a PROLIXIN ANTAGONIST, wherein said ANTAGONIST is a soluble fragment of PROLIXIN polypeptide. More preferably the invention is directed to purified, isolated, or recombinant soluble fragments of PROLIXIN polypeptide. More preferably the invention is directed to said soluble fragment of PROLIXIN polypeptide, wherein said soluble fragment binds LIGAND and blocks LIGAND activity, said activity being selected from the group consisting of lipid partitioning, lipid metabolism, and insulin-like activity or described herein, and wherein said soluble fragment of PROLIXIN polypeptide does not activate PROLLXIN. Preferably said soluble fragment of PROLIXIN polypeptide blocks or inhibits LIGAND binding to PROLLXIN. In preferred embodiments, said soluble fragment of PROLIXIN polypeptide comprises, consists essentially of, or consists of, at least 6 and not more than 76 consecutive amino acids of SEQ ID NO:2, more preferably of amino acids comprising the extracellular domain of PROLLXIN. Preferred said soluble fragment of PROLIXIN comprises the extracellular domain of mature PROLLXIN polypeptide. Particularly preferred soluble fragment of PROLLXIN comprises amino acids 1-39, 2-39, 1-42, 2-42, 1-44, 2-44, 1-51, 2-51, 1-54, 2-54, 1-58, 2-58, 1-63, 2-63, 1-67, 2-67, 1-72, 2-72, 1-76 or 2-76 of SEQ ID NO:2. In other preferred embodiments, said soluble fragment of PROLLXIN polypeptide comprises an amino acid sequence at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to the corresponding consecutive amino acids of SEQ ID NO:2. Further preferred embodiments include heterologous polypeptides comprising a PROLLXF polypeptide of the invention. In further preferred embodiment, a PROLLXIN polypeptide of the invention is conjugated at its N- or C- terminus to an antibody Fc region or portion thereof. In a further preferred embodiment, the invention is directed to a PROLIXIN
ANTAGONIST, wherein said ANTAGONIST is an antibody that specifically binds PROLLXIN. More preferably the invention is directed to said PROLLXIN antibody, wherein said PROLIXIN antibody binds PROLLXIN and blocks LIGAND activity, said activity being selected from the group consisting of lipid partitioning, lipid metabolism, and insulin-like activity or described herein, and wherein said PROLIXIN antibody does not activate PROLLXP . Preferably said PROLLXIN antibody blocks or inhibits LIGAND binding to PROLLXIN.
In a further preferred embodiment, the invention is directed to a PROLLXIN ANTAGONIST, wherein said ANTAGONIST is a compound excluding said soluble fragment of PROLIXIN polypeptide and said PROLIXIN antibody (e.g., small organic molecule, protein, peptide). More preferably the invention is directed to said compound, wherein said compound binds to PROLIXIN and blocks LIGAND activity, said activity being selected from the group consisting of lipid partitioning, lipid metabolism, and insulin-like activity or described herein, and wherein said compound does not activate PROLIXIN. Preferably said compound that binds to PROLIXIN blocks or inhibits LIGAND binding to PROLIXIN. Further more preferably the invention is directed to said compound, wherein said compound blocks or inhibits LIGAND activity exclusive of binding to PROLIXIN, said activity being selected from the group consisting of lipid partitioning, lipid metabolism, and insulin-like activity or described herein, and wherein said compound does not activate PROLIXIN. Further more preferably the invention is directed to said compound, wherein said compound blocks or inhibits PROLLXPN expression and wherein said compound does not have LIGAND activity, said activity being selected from the group consisting of lipid partitioning, lipid metabolism, and insulin-like activity or described herein, and wherein said compound does not activate PROLIXIN.
In a further preferred embodiment, the invention is directed to a PROLIXIN ANTAGONIST, wherein said ANTAGONIST is a variant or fragment of LIGAND polypeptide. More preferably the invention is directed to said variant of fragment of LIGAND polypeptide, wherein said variant or fragment of LIGAND polypeptide binds PROLLXPN and blocks LIGAND activity, said activity being selected from the group consisting of lipid partitioning, lipid metabolism, and insulin-like activity or described herein, and wherein said variant or fragment of LIGAND polypeptide does not activate PROLIXIN. Preferably said variant or fragment of LIGAND polypeptide blocks or inhibits LIGAND binding to PROLIXIN. More preferably the invention is directed to said variant or fragment of LIGAND polypeptide, wherein said variant or fragment of LIGAND polypeptide inhibits the induction, enhancement, or potentiation of said biological activity exclusive of binding to PROLLXPN.
In a further preferred embodiment, the invention is directed to a PROLIXIN ANTAGONIST that selectively binds to a polypeptide comprising the extracellular domain of PROLIXIN. In a further preferred embodiment, said ANTAGONIST is able to raise circulating (either blood, serum or plasma) levels (concentration) of: (i) free fatty acids, (ii) glucose, and/or
(iii) triglycerides.
Further preferred said ANTAGONISTS are those that significantly inhibit muscle lipid or free fatty acid oxidation stimulated by its LIGAND. Further preferred said ANTAGONISTS are those that cause C2C12 cells differentiated in the presence of LIGAND to undergo at least 10%, 20%, 30%, 35%, or 40% less oleate oxidation as compared to untreated cells.
Further preferred said ANTAGONISTS are those that inhibit by at least 10%, 20%, 30%, 35%, or 40% the increase in leptin uptake stimulated by LIGAND polypeptide in a liver cell line [preferably BPRCL mouse liver cells (ATCC CRL-2217)] as compared to untreated cells.
Further preferred said ANTAGONISTS are those that significantly increase the postprandial increase in plasma free fatty acids, particularly following a high fat meal.
Further preferred said ANTAGONISTS are those that significantly increase ketone body production, particularly following a high fat meal. Further preferred said ANTAGONISTS are those that decrease glucose uptake in skeletal muscle cells stimulated by LIGAND.
Further preferred said ANTAGONISTS are those that decrease glucose uptake in adipose cells stimulated by LIGAND.
Further preferred said ANTAGONISTS are those that decrease glucose uptake in neuronal cells stimulated by LIGAND.
Further preferred said ANTAGONISTS are those that decrease glucose uptake in red blood cells stimulated by LIGAND.
Further preferred said ANTAGONISTS are those that decrease glucose uptake in the brain stimulated by LIGAND. Further preferred said ANTAGONISTS are those that significantly increase the postprandial increase in plasma glucose following a meal, particularly a high carbohydrate meal.
Further preferred said ANTAGONISTS are those that significantly facilitate the postprandial increase in plasma glucose following a meal, particularly a high fat or a high carbohydrate meal. Further preferred said ANTAGONISTS are those that reduce the insulin sensitivity stimulated by LIGAND.
Further preferred said ANTAGONISTS are those that increase body mass, wherein said increase in body mass is comprised of a change in mass of the subcutaneous adipose tissue. Further preferred said ANTAGONISTS are those that increase body mass, wherein said increase in body mass is comprised of a change in mass of the visceral (omental) adipose tissue.
In a thirteenth aspect, the invention features a pharmaceutical or physiologically acceptable composition comprising, consisting essentially of, or consisting of, said ANTAGONIST described in the twelfth aspect and, alternatively, a pharmaceutical or physiologically acceptable diluent.
In a fourteenth aspect, the invention features a method of increasing body mass comprising providing or administering to individuals in need of increasing body mass said pharmaceutical or physiologically acceptable composition described in the thirteenth aspect.
In a fifteenth aspect, the invention features a method of preventing or treating disorders associated with excessive weight loss comprising providing or administering to an individual in need of such treatment said pharmaceutical or physiologically acceptable composition described in the thirteenth aspect. Preferably said disorder is selected from the group consisting of cachexia, wasting, cancer-related weight loss, AJDS-related weight loss, chronic inflammatory disease-related weight loss, anorexia, and bulimia. Said disorders associated with excessive weight loss are comprised of those mediated by tumor necrosis factor (TNFalpha) alone, those mediated by TNFalpha plus one or more additional factors, and those mediated only by one or more factors exclusive of TNFalpha. Said factors include, but are not restricted to, macrophage migration inhibitory factor, interleukin 1, and interleukm 6. In preferred embodiments, said individual is a mammal, preferably a human. In related aspects, embodiments of the present invention includes methods of causing or inducing a desired biological response in an individual comprising the steps of: providing or administering to an individual a composition comprising ANTAGONIST, wherein said biological response is selected from the group consisting of:
(a) raising circulating (either blood, serum, or plasma) levels (concentration) of free fatty acids (FFA) or triglycerides (TG);
(b) raising circulating (either blood, serum or plasma) levels (concentration) of glucose;
(c) raising circulating (either blood, serum or plasma) levels (concentration) of triglycerides;
(d) inhibiting muscle lipid or free fatty acid oxidation; (c) inhibiting leptin uptake in the liver or liver cells;
(e) increasing the postprandial increase in plasma free fatty acids, particularly following a high fat meal; and,
(f) increasing or eliminating ketone body production, particularly following a high fat meal; (g) reducing tissue sensitivity to insulin, particularly muscle, adipose, liver or brain, and further wherein said biological response is greater than a transient response; or alternatively wherein said biological response is sustained. In further preferred embodiments, the present invention of said pharmaceutical or physiologically acceptable composition can be used as a method of increasing body mass in some persons with cachexia, wasting, cancer-related weight loss, AIDS- related weight loss, chronic inflammatory disease-related weight loss, anorexia, and bulimia.
In further preferred embodiments, the present invention of said pharmaceutical or physiologically acceptable composition further provides a method for the use as an insulin de- sensitiser, wherein the sensitivity of a cell or tissue to insulin is reduced. a sixteenth aspect, the invention features a method of making the PROLLXPN polypeptide described in the twelfth aspect, wherein said method is selected from the group consisting of proteolytic cleavage, recombinant methodology and artificial synthesis, hi a preferred embodiment, proteolytic cleavage is carried out using trypsin, plasmin, or collagenase. hi a seventeenth aspect, the invention features a use of ANTAGONIST described in the twelfth aspect for the preparation of a medicament for the treatment of disorders associated with excessive weight loss and/or for increasing body mass. Preferably, said disorder is selected from the group consisting of cachexia, wasting, cancer-related weight loss, AIDS-related weight loss, chronic inflammatory disease-related weight loss, anorexia, and bulimia. In preferred embodiments, said individual is a mammal, preferably a human. hi an eighteenth aspect, the invention provides ANTAGONIST of the twelfth aspect of the invention, or a composition of the thirteenth aspect of the invention, for use in a method of treatment of the human or animal body.
In a nineteenth aspect, the invention features methods of increasing body weight comprising providing to an individual said pharmaceutical or physiologically acceptable composition described in the thirteenth aspect, or ANTAGONIST described in the twelfth aspect. Where the increase of body weight is practiced for cosmetic purposes, the individual has a BMI of no greater than 25 and at least 20. In embodiments for the treatment of disorders associated with excessive weight loss, the individual may have a BMI no greater than 20. One embodiment for the treatment of disorders associated with excessive weight loss provides for the treatment of individuals with BMI values of no greater than 15. Alternatively, for increasing the body weight of an individual, the BMI value should be at least 15 and no more than 20.
In a twentieth aspect, the invention features the pharmaceutical or physiologically acceptable composition described in the thirteenth aspect for increasing body mass and/or for treatment of disorders associated with excessive weight loss. Preferably, said disorder is selected from the group consisting of cachexia, wasting, cancer-related weight loss, AIDS-related weight loss, chronic inflammatory disease-related weight loss, anorexia, and bulimia. In preferred embodiments, said individual is a mammal, preferably a human.
In a twenty-first aspect, the invention features the pharmaceutical or physiologically acceptable composition described in the thirteenth aspect for increasing body weight for cosmetic reasons.
In a preferred aspect of the methods above and disclosed herein, the amount of
ANTAGONIST administered to an individual is sufficient to bring levels of PROLIXIN activation to their normal levels (levels in healthy individuals). "Normal levels" of PROLIXIN activation may be followed using surrogate markers including circulating (either blood, serum or plasma) levels (concentration) of: (i) free fatty acids, (ii) glucose, and/or (iii) triglycerides.
Brief Description of Tables
Table 1 lists known or predicted biologic structural and functional domains for the PROLIXIN polypeptide of SEQ ID NO:2 of the present invention, including the extracellular (EC) domain, transmembrane domain, and intracellular (IC) domain. Table 2 lists the amino acid sequence of full-length APMl, C2P, ZADJ-2 and ZADJ-7 polypeptide. The total number of amino acids is given in parentheses. The predicted signal peptide is indicated in bold. The collagen-like region is indicated by dotted line. The region between the predicted signal peptide and the collagen-like region is the N-terminally disposed unique region. The globular C-terminal Clq homology domain is indicated by single underline. The NGLXXD amino acid motif C-terminally disposed within the globular domain is indicated by double underline. It is taken to be understood that C2P herein encompasses variants comprising the substitution of valine for methionine at position 219 and/or the substitution of methionine for valine at position 301.
Structure of PROLLXPN Polypeptide
The full-length PROLIXIN polypeptide is comprised of at least 3 distinct regions including: 1. an extracellular domain comprising a LIGAND binding portion and comprising amino acids from about amino acids 1-76 of SEQ ID NO:2;
2. a transmembrane domain comprising amino acids from about amino acids 77-99 of SEQ ID NO:2; and
3. an intracellular domain comprising amino acids from about amino acids 100-184 of SEQ ID NO:2.
Brief Description of Sequence Listing
SEQ ID NO:l is the nucleotide sequence of cDNA with an open reading frame which location is indicated as features. When appropriate, the locations of the potential polyadenylation site and polyadenylation signal are also indicated. SEQ ID NO: 2 is the amino acid sequence of polypeptide encoded by the cDNA of SEQ ID
NO:l.
The appended Sequence Listing is hereby incorporated by reference in its entirety.
Detailed Description Definitions
Before describing the invention in greater detail, the following definitions are set forth to illustrate and define the meaning and scope of the terms used to describe the invention herein.
The term "isolated" requires that the material be removed from its original environment (e. g., the natural environment if the material is naturally occurring). The term "purified" does not require absolute purity; rather, it is intended as a relative definition. Purification of starting material or natural material to at least one order of magnitude, preferably two or three orders, and more preferably four or five orders of magnitude is expressly contemplated.
As used interchangeably herein, the term "polynucleotide(s)" include RNA or DNA (either single or double stranded, coding, complementary or antisense), or RNA/DNA hybrid sequences of more than one nucleotide in either single chain or duplex form (although each of the above species may be particularly specified).
The terms "complementary" or "complement thereof are used herein to refer to the sequences of polynucleotides that are capable of forming Watson & Crick base pairing with another specified polynucleotide throughout the entirety of the complementary region.
The terms "polypeptide" and "protein", used interchangeably herein, refer to a polymer of amino acids without regard to the length of the polymer; thus, peptides, oligopeptides, and proteins are included within the definition of polypeptide. This term also does not specify or exclude chemical or post-expression modifications of the polypeptides of the invention, although chemical or post-expression modifications of these polypeptides may be included excluded as specific embodiments.
As used herein, the terms "recombinant polynucleotide" and "polynucleotide construct" are used interchangeably to refer to linear or circular, purified or isolated polynucleotides that have been artificially designed and which comprise at least two nucleotide sequences that are not found as contiguous nucleotide sequences in their initial natural environment. In particular, these terms mean that the polynucleotide or cDNA is adjacent to "backbone" nucleic acid to which it is not adjacent in its natural environment.
The term "recombinant polypeptide" is used herein to refer to polypeptides that have been artificially designed and which comprise at least two polypeptide sequences that are not found as contiguous polypeptide sequences in their initial natural environment, or to refer to polypeptides which have been expressed from a recombinant polynucleotide.
As used herein, the term "operably linked" refers to a linkage of polynucleotide elements in a functional relationship. As used herein, the term "non-human animal" refers to any non-human animal, including insects, birds, rodents and more usually mammals. Both the terms "animal" and "mammal" expressly embrace human subjects unless preceded with the term "non-human".
The term "domain" refers to an amino acid fragment with specific biological properties. This term encompasses all known structural and linear biological motifs. As used herein, the term "receptor" refers to a polypeptide to which a "ligand" binds and through which said "ligand" elicits a biological response comprised of biological activities. Said receptor is preferably PROLIXIN of the present invention. Said "ligand" is preferably LIGAND of the present invention. By "receptor activation" is intended "ligand"-mediated alteration of said receptor polypeptide, wherein said alteration is selected from but not limited to the group consisting of receptor alterations associated with said biological response.
As used herein, the term "AGONIST" refers to naturally occurring and synthetic compounds capable of inducing, enhancing, or potentiating a biological response comprised of biological activities.
As used herein, the term "ANTAGONIST" refers to naturally occurring and synthetic compounds capable of inhibiting a biological response, inhibiting the induction of a biological response, or inhibiting the potentiation of a biological response, wherein said biological response is comprised of biological activities.
Without being limited by theory, the compounds/polypeptides of the invention are capable of modulating the partitioning of dietary lipids between the liver and peripheral tissues, and are thus believed to treat "diseases involving the partitioning of dietary lipids between the liver and peripheral tissues." The term "peripheral tissues" is meant to include muscle and adipose tissue. In preferred embodiments, the compounds/polypeptides of the invention partition the dietary lipids toward or away from the muscle. In alternative preferred embodiments, the dietary lipids are partitioned toward or away from the adipose tissue. In other preferred embodiments, the dietary lipids are partitioned toward or away from the liver. In yet other preferred embodiments, the compounds/polypeptides of the invention increase or decrease the oxidation of dietary lipids, preferably free fatty acids (FFA) by the muscle. Dietary lipids include, but are not limited to triglycerides and free fatty acids.
Preferred diseases believed to involve the partitioning of dietary lipids include obesity- related diseases and disorders such as obesity, insulin resistance, atherosclerosis, atheromatous disease, heart disease, hypertension, stroke, Syndrome X, Noninsulin Dependent Diabetes Mellitus
(NIDDM, or Type II diabetes) and Insulin Dependent Diabetes Mellitus (IDDM or Type I diabetes). Diabetes-related complications to be treated by the methods of the invention include microangiopathic lesions, ocular lesions, retinopathy, neuropathy, and renal lesions. Heart disease includes, but is not limited to, cardiac insufficiency, coronary insufficiency, and high blood pressure. Other obesity-related disorders to be treated by compounds of the invention include hyperlipidemia and hyperuricemia. Yet other disorders of the invention include disorders associated with excessive weight loss such as cachexia, wasting, cancer-related weight loss, AIDS-related weight loss, chronic inflammatory disease-related weight loss, anorexia, and bulimia. The terms "comprising", "consisting of and "consisting essentially of may be interchanged for one another throughout the instant application, although each retains its normal definition. The term "having" has the same meaning as "comprising" and may be replaced with either the term "consisting of or "consisting essentially of.
Polypeptides of the Invention Preferably, polypeptides of the invention are recombinantly produced using routine expression methods known in the art. The polynucleotide encoding the desired polypeptide is operably linked to a promoter into an expression vector suitable for any convenient host. Both eukaryotic and prokaryotic host systems are used in forming recombinant polypeptides. The polypeptide is then isolated from lysed cells or from the culture medium and purified to the extent needed for its intended use.
Consequently, a further embodiment of the present invention is a method of making a polypeptide, said method comprising the steps of a) obtaining a cDNA encoding said polypeptide; b) inserting said cDNA in an expression vector such that the cDNA is operably linked to a promoter; and c) introducing said expression vector into a host cell whereby said host cell produces said polypeptide.
In one aspect of this embodiment, the method further comprises the step of isolating the polypeptide. Another embodiment of the present invention is a polypeptide obtainable by the method described in the preceding paragraph.
The expression vector is any of the mammalian, yeast, insect or bacterial expression systems known in the art. Commercially available vectors and expression systems are available from a variety of suppliers including Genetics Institute (Cambridge, MA), Stratagene (La Jolla, California),
Promega (Madison, Wisconsin), and Ixivitrogen (San Diego, California). In preferred embodiment, recombinant polypeptides of the invention are expressed in mammalian cells. The invention is drawn, inter alia, to isolated, purified or recombinant polypeptides.
PROLLXFN polypeptides of the invention are useful for increasing (ANTAGONISTS of
PROLIXIN) body weight either as a cosmetic treatment or for treatment or prevention of diseases and disorders as discussed or described herein. PROLIXIN polypeptides are also useful inter alia in screening assays for AGONISTS or ANTAGONISTS of PROLLXESf activity and for raising
PROLLXLN-specific antibodies. When used for cosmetic treatments, or for the treatment or prevention of diseases, disorders, or conditions, one or more PROLIXIN polypeptides can be provided to a subject. Thus, various fragments of the full-length protein can be combined into a
"cocktail" for use in the various treatment regimens. LIGAND polypeptides of the invention are useful for reducing (AGONISTS of PROLIXIN) body weight either as a cosmetic treatment or prevention of diseases and disorders as discussed or described herein.
The PROLLXPN polypeptides of the present invention are preferably provided in an isolated form, and may be partially or substantially purified.
Modifying PROLLXPN biological activity Modifying endogenous PROLIXIN biological activity is expressly contemplated by the present invention. The present invention further relates to compounds able to modulate PROLIXIN biological activity and methods to use these compounds. Such compounds may interact with PROLLXFN polypeptides directly or indirectly.
Candidate AGONISTS and ANTAGONISTS Obtained by Optical Biosensor Methods Compounds interacting with a polypeptide comprising PROLLXESf extracellular domain can be screened by using an Optical Biosensor as described in Edwards and Leatherbarrow (1997) and also in Szabo et al. (1995), the disclosures of which are incorporated by reference. This technique permits the detection of interactions between molecules in real time, without the need of labeled molecules. This technique, which is based on the surface plasmon resonance (SPR) phenomenon, is presented in more detail in Example 1.
Compounds Modulating PROLIXIN Biological Activity
Another method of screening for compounds that modulate PROLLXFN biological activity is by measuring the effects of test compounds on specific biological activity, wherein said activity is selected from the group consisting of lipid partitioning, lipid metabolism, and insulin-like activity or as described herein, in a host cell. In one embodiment, the present invention relates to a method of identifying an agent that alters PROLIXIN activity, wherein a nucleic acid construct comprising the polynucleotide of SEQ ID NO: 1 or a fragment thereof encoding full-length PROLLXFN polypeptide is introduced into a mammalian host cell. The transfected mammalian host cells are maintained under conditions appropriate for expression of the encoded PROLIXIN, whereby the nucleic acid is expressed. The host cells are then contacted with a compound to be assessed (an agent) and an activity of the cells is detected in the presence of the compound to be assessed, wherein said activity is selected from the group consisting of lipid partitioning, lipid metabolism, and insulin-like activity or as described herein. Detection of a change in said activity for said transfected host cell, but not in untransfected host cell, in the presence of the agent indicates that the agent alters PROLIXIN activity, hi a particular embodiment, the invention relates to a method of identifying an agent which is an activator (AGONIST) of PROLIXIN activity, wherein detection of an increase of said activity, said activity being selected from the group consisting of lipid partitioning, lipid metabolism, and insulin-like activity or as described herein, in the presence of the agent indicates that the agent activates PROLLXPN activity. In another particular embodiment, the invention relates to a method of identifying an agent which is an inhibitor (ANTAGONIST) of PROLIXIN activity, wherein detection of a decrease of said activity, said activity being selected from the group consisting of lipid partitioning, lipid metabolism, and insulin-like activity or as described herein, in the presence of the agent indicates that the agent inhibits PROLLXPN activity.
Detection of a change in said PROLLXFN activity, said activity being selected from the group consisting of lipid partitioning, lipid metabolism, and insulin-like activity or as described herein, can be performed using a variety of techniques as described for representative activities in Examples provided herein.
In a particular embodiment a high throughput screen can be used to identify agents that activate (enhance) or inhibit PROLIXIN activity (See e.g., PCT publication WO 98/45438, which disclosure is hereby incorporated by reference in its entirety).
Methods of Screening for Compounds Modulating PROLLXPN Activity
The present invention also relates to methods of screening compounds for their ability to modulate (e.g. increase or inhibit) the activity or expression of PROLLXFN. More specifically, the present invention relates to methods of testing compounds for their ability either to increase or to decrease activity of PROLLXFN. The assays are performed in vitro or in vivo.
The present invention relates to a method for the screening of a candidate substance for interaction with a polypeptide comprising PROLLXFN extracellular domain, said method comprising the following steps: a) providing said polypeptide comprising PROLIXIN extracellular domain; b) obtaining a candidate substance; c) bringing into contact said polypeptide with said candidate substance; d) detecting the complexes formed between said polypeptide and said candidate substance. The invention further relates to a method for the production of a pharmaceutical composition comprising a method for the screening of a candidate substance that interact with a PROLIXIN polypeptide, fragments or variants thereof and furthermore mixing the identified substance with a pharmaceutically acceptable carrier. The present invention relates to a method for the screening of a candidate substance for the capacity to increase expression of PROLLXFN, said method comprising the following steps: a) isolating mRNA from cells which have or have not been contacted with said candidate substance; b) carrying out a Northern blot analysis with labeled cDNA probe encoding all or part of PROLLXFN polypeptide; c) wherein increased signal in cells having been contacted with said candidate substance over that of uncontacted cells is taken to indicate that said candidate substance increases expression of PROLLXIN and is an AGONIST of PROLLXESf activity; and d) wherein decreased signal in cells having been contacted with said candidate substance over that of uncontacted cells is taken to indicate that said candidate substance decreases expression of PROLIXIN and is an ANTAGONIST of PROLLXPN activity.
Methods of isolating mRNA and carrying out Northern blot analysis are well known to those of ordinary skill in the art.
Preparation of Antibody Compositions
Substantially pure protein or polypeptide is isolated from transfected or transformed cells containing an expression vector encoding the PROLLXFN protein or a portion thereof. The concentration of protein in the final preparation is adjusted, for example, by concentration on an Amicon filter device, to the level of a few micrograms/ml. Monoclonal or polyclonal antibody to the protein can then be prepared by methods well known to those of ordinary skill in the art.
Preferably the present invention includes monoclonal and polyclonal antibodies that specifically bind PROLIXIN polypeptide fragment comprising the extracellular domain of mature
PROLLXESf polypeptide. Particularly preferred soluble fragment of PROLIXIN comprises amino acids 1-39, 2-39, 1-42, 2-42, 1-44, 2-44, 1-51, 2-51, 1-54, 2-54, 1-58, 2-58, 1-63, 2-63, 1-67, 2-67,
1-72, 2-72, 1-76 or 2-76 of SEQ ID NO:2.
EXAMPLES The following Examples are provided for illustrative purposes and not as a means of limitation. One of ordinary skill in the art would be able to design equivalent assays and methods based on the disclosure herein all of which form part of the instant invention.
EXAMPLE 1: Use of Biacore Technology to Detect Specific Binding of a Test Compound to Polypeptide Fragment Comprising PROLLXFN Extracellular Domain
Biacore utilizes a biosensor technology for monitoring interactions between two or more molecules in real time, without the use of labels. The molecular classes than can be studied are diverse, ranging from proteins, peptides, nucleic acids, carbohydrates, and lipids to low molecular weight substances and pharmaceuticals. The detection principle is based on the optical phenomena of surface plasmon resonance, which detects changes in refractive index close to a biosensor surface. In a typical experiment one of the interacting molecules is immobilized or captured (here, polypeptide fragment comprising PROLLXFN extracellular domain) to a flexible dextran layer close to the sensor surface. The interacting partner (here, test compound) is flowed across that surface. If an interaction occurs between the two molecules, there is a resulting increase in signal due to the increase in mass at the chip surface.
Soluble polypeptide fragment comprising PROLLXFN extracellular domain is attached to the sensor surface via amine coupling chemistry. The dextran is activated using N-hydroxysuccinimide and N-ethyl-N'-(3-dimethylaminopropyl)-carbodiimide hydrochloride for 7 minutes. Said PROLLXPN polypeptide fragment is diluted in lOmM Na Acetate pH 5.0 at a concentration of lOμg/ml and injected over the activated surface for 7 minutes. The surface is then blocked for 7 minutes using ethanolamine to remove any remaining esters. A blank flow cell absent said PROLLXESf polypeptide fragment is set up in parallel and used as a control surface. The running buffer is HBS-EP (0.01M HEPES pH 7.4, 0.15M NaCl, 3mM EDTA, 0.005% Surfactant P20) and the instrument temperature is 25°C.
The test compound is filtered through an Ultrafree-0.5 Centrifugal Filter Device and resuspended in HBS-EP running buffer. The test compound is then diluted 1:10 in HBS-EP and injected over the said PROLLXPN polypeptide fragment surface and the blank control surface for 1 minute at a flow rate of 50 μl/min. The sensorgrams from the receptor surface and the control surface are aligned and overlayed.
To obtain the specific binding, the control surface was subtracted from the active surface comprised of said PROLLXPN polypeptide fragment.
Example 2: Effect of LIGAND on Muscle Cell Fatty Acid Oxidation
C2C12 cells are differentiated in the presence or absence of 2 μg/mL LIGAND for 4 days. On day 4, oleate oxidation rates are determined by measuring conversion of l-14C-oleate (0.2 mM) to 14C02 for 90 min. This experiment can be used to screen for active polypeptides and peptides as well as AGONISTS and ANTAGONISTS or activators and inhibitors of LIGAND receptor.
The effect of LIGAND on the rate of oleate oxidation can be compared in differentiated
C2C12 cells (murine skeletal muscle cells; ATCC, Manassas, VA CRL-1772) and in a hepatocyte
5 cell line (Hepal-6; ATCC, Manassas, VA CRL-1830). Cultured cells are maintained according to manufacturer's instructions. The oleate oxidation assay is performed as previously described
(Muoio et al (1999) Biochem J 338;783-791). Briefly, nearly confluent myocytes are kept in low serum differentiation media (DMEM, 2.5% Horse serum) for 4 days, at which time formation of myotubes became maximal. Hepatocytes are kept in the same DMEM medium supplemented with
10 10% FCS for 2 days. One hour prior to the experiment the media is removed and 1 mL of preincubation media (MEM, 2.5% Horse serum, 3 mM glucose, 4 mM Glutamine, 25 mM Hepes, 1% FFA free BSA, 0.25 mM Oleate, 5 μg/mL gentamycin) is added. At the start of the oxidation experiment 14C-01eic acid (lμCi/mL, American Radiolabelled Chemical Inc., St. Louis, MO) is added and cells are incubated for 90 min at 37°C in the absence/presence of 2.5 μg/mL LIGAND.
15 After the incubation period 0.75 mL of the media is removed and assayed for 14C-oxidation products as described below for the muscle FFA oxidation experiment.
EXAMPLE 3: Effect of LIGAND on In Vitro Glucose Uptake by Muscle Cells
L6 Muscle cells are obtained from the European Culture Collection (Porton Down) and are used at passages 7-11. Cells are maintained in standard tissue culture medium DMEM, and glucose
20 uptake is assessed using [3H]-2-deoxyglucose (2DG) with or without LIGAND in the presence or absence of insulin (10"8 M) as has been previously described (Walker, P.S. et al. (1990) Glucose transport activity in L6 muscle cells is regulated by the coordinate control of subcellular glucose transporter distribution, biosynthesis, and mRNA transcription. JBC 265(3): 1516-1523; and Kilp, A. et al. (1992) Stimulation of hexose transport by metformin in L6 muscle cells in culture.
25 Endocrinology 130(5):2535-2544, which disclosures are hereby incorporated by reference in their entireties). Uptake of 2DG is expressed as the percentage change compared with control (no added insulin orLIGAND). Values are presented as mean ± SEM of sets of 4 wells per experiment. Differences between sets of wells are evaluated by Student's t test, probability values p<0.05 are considered to be significant.
30 EXAMPLE 4: Effect of LIGAND on Mice Fed a High-Fat Diet
Experiments are performed using approximately 6 week old C57B1/6 mice (8 per group). All mice are housed individually. The mice are maintained on a high fat diet throughout each experiment. The high fat diet (cafeteria diet; D 12331 from Research Diets, Inc.) has the following composition: protein kcal% 16, sucrose kcal% 26, and fat kcal% 58. The fat is primarily composed 35 of coconut oil, hydrogenated.
After the mice are fed a high fat diet for 6 days, micro-osmotic pumps are inserted using isoflurane anesthesia, and are used to provide LIGAND, saline, and an irrelevant peptide to the mice subcutaneously (s.c.) for 18 days. LIGAND is provided at doses of 100, 50, 25, and 2.5 μg/day and the irrelevant peptide is provided at 10 μg/day. Body weight is measured on the first, third and fifth day of the high fat diet, and then daily after the start of treatment. Final blood samples are taken by cardiac puncture and are used to determine triglyceride (TG), total cholesterol (TC), glucose, leptin, and insulin levels. The amount of food consumed per day is also determined for each group.
EXAMPLE 5 : Effect of LIGAND on Plasma Free Fatty Acid in C57 BL/6 Mice
The effect of LIGAND on postprandial lipemia (PPL) in normal C57BL6/J mice is tested.
The mice used in this experiment are fasted for 2 hours prior to the experiment after which a baseline blood sample is taken. All blood samples are taken from the tail using EDTA coated capillary tubes (50 μL each time point). At time 0 (8:30 AM), a standard high fat meal (6g butter, 6 g sunflower oil, 10 g nonfat dry milk, 10 g sucrose, 12 mL distilled water prepared fresh following
Nb#6, JF, pg.l) is given by gavage (vol.=l% of body weight) to all animals.
Immediately following the high fat meal, 25μg a LIGAND is injected i.p. in 100 μL saline.
The same dose (25μg/mL in lOOμL) is again injected at 45 min and at 1 hr 45 min. Control animals are injected with saline (3xl00μL). Untreated and treated animals are handled in an alternating mode.
Blood samples are taken in hourly intervals, and are immediately put on ice. Plasma is prepared by centrifugation following each time point. Plasma is kept at -20°C and free fatty acids
(FFA), triglycerides (TG) and glucose are determined within 24 hours using standard test kits (Sigma and Wako). Due to the limited amount of plasma available, glucose is determined in duplicate using pooled samples. For each time point, equal volumes of plasma from all 8 animals per treatment group are pooled.
EXAMPLE 6: Effect of LIGAND on Plasma FFA. TG and Glucose in C57 BL/6 Mice
Briefly, 14 mice re fasted for 2 hours prior to the experiment after which a baseline blood sample is taken. All blood samples are taken from the tail using EDTA coated capillary tubes (50 μL each time point). At time 0 (9:00AM), a standard high fat meal (see Example 6) is given by gavage (vol.=l% of body weight) to all animals. Immediately following the high fat meal, 4 mice are injected 25 μg of LIGAND i.p. in lOOμL saline. The same dose (25μg in lOOμL) is again injected at 45 min and at 1 hr 45 min. A second treatment group receives 3 times 50 μg LIGAND at the same intervals. Control animals are injected with saline (3xl00μL). Untreated and treated animals are handled in an alternating mode.
Blood samples are immediately put on ice. Plasma is prepared by centrifugation following each time point. Plasma is kept at -20 °C and free fatty acids (FFA), triglycerides (TG) and glucose are determined within 24 hours using standard test kits (Sigma and Wako). EXAMPLE 7: Effect of LIGAND on FFA following Epinephrine Injection
In mice, plasma free fatty acids increase after intragastric administration of a high fat/sucrose test meal. These free fatty acids are mostly produced by the activity of lipolytic enzymes i.e. lipoprotein lipase (LPL) and hepatic lipase (HL). In this species, these enzymes are found in significant amounts both bound to endothelium and freely circulating in plasma. Another source of plasma free fatty acids is hormone sensitive lipase (HSL) that releases free fatty acids from adipose tissue after β-adrenergic stimulation. To test whether LIGAND also regulates the metabolism of free fatty acid released by HSL, mice are injected with epinephrine.
Two groups of mice are given epinephrine (5μg) by intraperitoneal injection. A treated group is injected with a LIGAND (25 μg) one hour before and again together with epinephrine, while control animals receive saline. Plasma is isolated and free fatty acids and glucose are measured.
EXAMPLE 8: Effect of LIGAND on FFA following Intralipid Injection Two groups of mice are intravenously (tail vein) injected with 30 μL bolus of h tralipid-20%
(Clintec) to generate a sudden rise in plasma FFAs, thus by-passing intestinal absorption. (Intralipid is an intravenous fat emulsion used in nutritional therapy). A treated group (LIGAND-treated) is injected with LIGAND (25μg) at 30 and 60 minutes before Intralipid is given, while control animals receive saline. Plasma is isolated and FFAs are measured as described previously. The effect of LIGAND on the decay in plasma FFAs following the peak induced by Intralipid inj ection is then monitored.
EXAMPLE 9: Effect of LIGAND on Weight Gain and Weight Loss of Mice and on Maintenance of Weight Loss in Mice i the first experiment, 10-week-old male C57BL/6J mice are put on a very high fat/sucrose purified diet for 19 days to promote weight gain; the average body weight at this time is 30g. The mice are then surgically implanted with an osmotic pump (Alzet, Newark, DE) delivering either 2.5 μg/day of LIGAND or physiological saline. The mice are continued on the high fat diet and their body weight was recorded over the following 10-day period.
Weight gain by mice treated with saline in contradistinction to weight loss by mice treated with LIGAND is taken as evidence that in this inbred strain of normal mice, a continuous infusion of a daily low dose of LIGAND can prevent weight gain caused by high fat/sucrose feeding, in a sustainable way.
Data are expressed throughout as mean ± SEM; a p-value < 0.05 is considered statistically significant. Statistical analysis is typically done using either the unpaired Student's t test or the paired Student' s t test.
Maintenance of weight loss in mice
In order to demonstrate the ability of LIGAND to maintain weight loss, normal mice are put on a reduced calorie diet to promote weight loss. The reduced calorie diet is continued until the mice lose 10% of their initial weight. A second group of mice are continued on the reduced calorie diet until the mice lose 20%> of their initial weight. The mice are then surgically implanted with an osmotic pump (Alzet, Newark, DE) delivering either 2.5 μg/day of LIGAND or physiological saline. The mice are returned to a normal diet and their body weights are recorded over a 10-day period. After 10 days, the outcome wherein mice treated with LIGAND have a lower weight than mice treated with saline is taken to provide evidence that treatment with LIGAND promotes the maintenance of weight loss.
EXAMPLE 10: Assessment of homotrimer formation by gAPMl, gC2P. gZADJ-2 or gZADJ-7 polypeptide fragment.
Homotrimer formation by gAPMl, gC2P, gZADJ-2 or gZADJ-7 polypeptide fragment is assessed using sedimentation equilibrium in analytical centrifuges, a method that determines molecular weight accurately and independently of other physical factors such as shape.
Candidate gAPMl, gC2P, gZADJ-2 or gZADJ-7 polypeptide fragment homotrimer is purified, for example using a protocol comprising a method of gel filtration such as 16/60 superdex 200 gel filtration column (Amersham). Said purified candidate gAPMl, gC2P, gZADJ-2 or gZADJ- 7 polypeptide fragment homotrimer protein concentration is made 3 μM in 5.7 mM phosphate (pH 7.5), 137 mM NaCl, 2.7 mM KC1. Samples are centrifuged at 8,000 rpm for 18 hours at 10°C in a Beckman XL-A analytical ultracentrifuge before absorbance is recorded. The data are fit globally, using MacNonlin PPC [Johnson ML et al., Biophys J (1981) 36:575-8; Schuster TM et al., Curr Opin Struct Biol (1996) 6:650-8; Hensley P, Structure (1996) 4:367-73; the disclosures of which are incorporated herein by reference in their entirety] to the following equation that describes the sedimentation of a homogeneous species: Abs = B +A'exp[H x M (x2-Xo2] where Abs = absorbance at radius x, A'= absorbance at reference radius x0, H = (l-vp)ω2/2RT, R = gas constant, T = temperature in Kelvin, v = partial specific volume = 0.71896131 mL/g, p = density of solvent = 1.0061 g/ml, ω = angular velocity in radians/s, M = apparent molecular weight, and B = solvent absorbance (blank).
TABLE 1
Amino Acid Residues Comprising the Structural Domains of PROLLXESf
SEQ ID NO: 2 Description
TRANSMEMBRANE
EC DOMAIN DOMAIN IC DOMAIN
1-76 77-99 100-184
EC, extracellular domain; IC, intracellular domain
TABLE 2
APMl, C2P, ZADJ-2 and ZADJ-7
>APM1 polypeptide sequence: MLLLGAVLLLLALPGHDQETTTQGPGVLLPLPKGACTGWMAGffGHPGHNGAPGRDGRD GTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIOGRKGEPGEGAYVYRSAFSVGLET YVTIPNMPIPFTKIJYNOONirYDGSTGK HCNPGLYYFAYHITVYMKDVKVSLFK^ LFTYDOYOENNVDOASGSVLLHLEVGDOVWLOVYGEGERNGLYADNDNDSTFTGFLLYH DTN (244)
> C2P polypeptide sequence:
MMWWLLLAIEICTGNINSQDTCRQGHPGIPGNPGHNGLPGRDGRDGAKGDKGDAGEPG RPGSPGKDGTSGEKGERGADGKVEAKGIKGDQGSRGSPGKHGPKGLAGPMGEKGLRGETG PQGQKGNKGDVGPTGPEGPRGNIGPLGPTGLPGPMGPIGKPGPKGEAGPTGPQGEPGVRGIR GWKGDRGEKGKIGETLVLPKSAFTVGLTVLSKFPSSDMPIKFDKILYNEFNHYDTAAGKFTC HIAGVYYFTYHITVFSRNVOVSLVK^GVKILHTKDAYMSSEDOASGGIVLOLKLGDEVWLO VTGGERFNGLFADEDDDTTFTGFLLFSSP (333)
>ZADJ-2 polypeptide sequence: MIPWVLLACALPCAADPLLGAFARRDFRKGSPQLVCSLPGPQGPPGPPGAPGPSGMMGRM GFPGKDGQDGHDGDRGDSGEEGPPGRTGNRGKPGPKGKAGAIGRAGPRGPKGVNGTPGK HGTPGKKGPKGKXGEPGLPGPCSCGSGHTKSAFSVAVTKSYPRERLPIKFDKILMNEGGHY NASSGKFVCGVPGIYYFTYDITLANi LAIGLVHNGOYIARTFDANTGNIIDVASGSTILALK OGDEVWLOIFYSEONGLFYDPYWTDSLFTGFLlYADODDPNEV (285)
>ZADJ-7 polypeptide sequence:
MGKEDTQETRTEPKMFVLLYVTSFAICASGQPRGNQLKGENYSPRYICSIPGLPGPPGPPG ANGSPGPHGRIGLPGRDGRDGRKGEKGEKGTAGLRGKTGPLGLAGEKGDQGETGKKGPIG PEGEKGEVGPIGPPGPKGDRGEOGDPGLPGVCRCGSIVLKSAFSVGITTSYPEERLPIIFNKVL FNEGEHYNPATGKFICAFPGIYYFSYDITLANiπiLAIGLVHNGOYRIKTFDANTGNHDVASG STVIYLOPEDEVWLEIFFTDONGLFSDPGWADSLFSGFLLYVDTDYLDSISEDDEL (303)

Claims

What is claimed is:
1. A method of screening for an AGONIST or an ANTAGONIST of PROLIXIN activity.
2. The method of Claim 1, wherein said activity is selected from the group consisting of lipid partitioning, lipid metabolism, insulin-like activity, free fatty acid oxidation, and weight reduction.
3. An AGONIST or an ANTAGONIST of PROLLXIN activity.
4. The AGONIST or the ANTAGONIST of Claim 3, wherein said activity is selected from the group consisting of lipid partitioning, lipid metabolism, insulin-like activity, free fatty acid oxidation, and weight reduction.
5. A pharmaceutical or physiologically acceptable composition comprising, consisting essentially of, or consisting of the AGONIST or the ANTAGONIST of Claim 3.
6. A method of preventing or treating an obesity-related disease or disorder comprising providing or administering to an individual in need of such treatment the composition of Claim 5.
PCT/IB2002/004668 2001-11-29 2002-10-14 Agonists and antagonists of prolixin for the treatment of metabolic disorders WO2003045422A1 (en)

Priority Applications (3)

Application Number Priority Date Filing Date Title
AU2002339691A AU2002339691A1 (en) 2001-11-29 2002-10-14 Agonists and antagonists of prolixin for the treatment of metabolic disorders
EP02777740A EP1448226A1 (en) 2001-11-29 2002-10-14 Agonists and antagonists of prolixin for the treatment of metabolic disorders
US10/496,757 US7344843B2 (en) 2001-11-29 2002-10-14 Agonists and antagonists of prolixin for the treatment of metabolic disorders

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US33435701P 2001-11-29 2001-11-29
US60/334,357 2001-11-29

Publications (1)

Publication Number Publication Date
WO2003045422A1 true WO2003045422A1 (en) 2003-06-05

Family

ID=23306851

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/IB2002/004668 WO2003045422A1 (en) 2001-11-29 2002-10-14 Agonists and antagonists of prolixin for the treatment of metabolic disorders

Country Status (4)

Country Link
US (1) US7344843B2 (en)
EP (1) EP1448226A1 (en)
AU (1) AU2002339691A1 (en)
WO (1) WO2003045422A1 (en)

Cited By (71)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7112410B1 (en) 2001-08-29 2006-09-26 Human Genome Sciences, Inc. Human tumor necrosis factor TR21 and methods based thereon
EP2260858A2 (en) 2003-11-06 2010-12-15 Seattle Genetics, Inc. Monomethylvaline compounds capable of conjugation to ligands
EP2286844A2 (en) 2004-06-01 2011-02-23 Genentech, Inc. Antibody-drug conjugates and methods
WO2011031870A1 (en) 2009-09-09 2011-03-17 Centrose, Llc Extracellular targeted drug conjugates
WO2011056983A1 (en) 2009-11-05 2011-05-12 Genentech, Inc. Zirconium-radiolabeled, cysteine engineered antibody conjugates
WO2011130598A1 (en) 2010-04-15 2011-10-20 Spirogen Limited Pyrrolobenzodiazepines and conjugates thereof
WO2011156328A1 (en) 2010-06-08 2011-12-15 Genentech, Inc. Cysteine engineered antibodies and conjugates
WO2012074757A1 (en) 2010-11-17 2012-06-07 Genentech, Inc. Alaninyl maytansinol antibody conjugates
WO2012155019A1 (en) 2011-05-12 2012-11-15 Genentech, Inc. Multiple reaction monitoring lc-ms/ms method to detect therapeutic antibodies in animal samples using framework signature pepides
WO2013130093A1 (en) 2012-03-02 2013-09-06 Genentech, Inc. Biomarkers for treatment with anti-tubulin chemotherapeutic compounds
WO2014057074A1 (en) 2012-10-12 2014-04-17 Spirogen Sàrl Pyrrolobenzodiazepines and conjugates thereof
WO2014140862A2 (en) 2013-03-13 2014-09-18 Spirogen Sarl Pyrrolobenzodiazepines and conjugates thereof
WO2014140174A1 (en) 2013-03-13 2014-09-18 Spirogen Sàrl Pyrrolobenzodiazepines and conjugates thereof
WO2014159981A2 (en) 2013-03-13 2014-10-02 Spirogen Sarl Pyrrolobenzodiazepines and conjugates thereof
WO2015023355A1 (en) 2013-08-12 2015-02-19 Genentech, Inc. 1-(chloromethyl)-2,3-dihydro-1h-benzo[e]indole dimer antibody-drug conjugate compounds, and methods of use and treatment
WO2015095223A2 (en) 2013-12-16 2015-06-25 Genentech, Inc. Peptidomimetic compounds and antibody-drug conjugates thereof
WO2015095227A2 (en) 2013-12-16 2015-06-25 Genentech, Inc. Peptidomimetic compounds and antibody-drug conjugates thereof
WO2015095212A1 (en) 2013-12-16 2015-06-25 Genentech, Inc. 1-(chloromethyl)-2,3-dihydro-1h-benzo[e]indole dimer antibody-drug conjugate compounds, and methods of use and treatment
WO2016037644A1 (en) 2014-09-10 2016-03-17 Medimmune Limited Pyrrolobenzodiazepines and conjugates thereof
WO2016040856A2 (en) 2014-09-12 2016-03-17 Genentech, Inc. Cysteine engineered antibodies and conjugates
WO2016040825A1 (en) 2014-09-12 2016-03-17 Genentech, Inc. Anthracycline disulfide intermediates, antibody-drug conjugates and methods
WO2016090050A1 (en) 2014-12-03 2016-06-09 Genentech, Inc. Quaternary amine compounds and antibody-drug conjugates thereof
EP3088004A1 (en) 2004-09-23 2016-11-02 Genentech, Inc. Cysteine engineered antibodies and conjugates
US9562049B2 (en) 2012-12-21 2017-02-07 Medimmune Limited Pyrrolobenzodiazepines and conjugates thereof
US9567340B2 (en) 2012-12-21 2017-02-14 Medimmune Limited Unsymmetrical pyrrolobenzodiazepines-dimers for use in the treatment of proliferative and autoimmune diseases
WO2017059289A1 (en) 2015-10-02 2017-04-06 Genentech, Inc. Pyrrolobenzodiazepine antibody drug conjugates and methods of use
WO2017064675A1 (en) 2015-10-16 2017-04-20 Genentech, Inc. Hindered disulfide drug conjugates
WO2017068511A1 (en) 2015-10-20 2017-04-27 Genentech, Inc. Calicheamicin-antibody-drug conjugates and methods of use
WO2017165734A1 (en) 2016-03-25 2017-09-28 Genentech, Inc. Multiplexed total antibody and antibody-conjugated drug quantification assay
EP3235820A1 (en) 2014-09-17 2017-10-25 Genentech, Inc. Pyrrolobenzodiazepines and antibody disulfide conjugates thereof
WO2017201449A1 (en) 2016-05-20 2017-11-23 Genentech, Inc. Protac antibody conjugates and methods of use
WO2017205741A1 (en) 2016-05-27 2017-11-30 Genentech, Inc. Bioanalytical method for the characterization of site-specific antibody-drug conjugates
WO2017214024A1 (en) 2016-06-06 2017-12-14 Genentech, Inc. Silvestrol antibody-drug conjugates and methods of use
WO2018031662A1 (en) 2016-08-11 2018-02-15 Genentech, Inc. Pyrrolobenzodiazepine prodrugs and antibody conjugates thereof
US9919056B2 (en) 2012-10-12 2018-03-20 Adc Therapeutics S.A. Pyrrolobenzodiazepine-anti-CD22 antibody conjugates
US9931414B2 (en) 2012-10-12 2018-04-03 Medimmune Limited Pyrrolobenzodiazepine-antibody conjugates
US9931415B2 (en) 2012-10-12 2018-04-03 Medimmune Limited Pyrrolobenzodiazepine-antibody conjugates
WO2018065501A1 (en) 2016-10-05 2018-04-12 F. Hoffmann-La Roche Ag Methods for preparing antibody drug conjugates
US9950078B2 (en) 2013-10-11 2018-04-24 Medimmune Limited Pyrrolobenzodiazepine-antibody conjugates
US9956299B2 (en) 2013-10-11 2018-05-01 Medimmune Limited Pyrrolobenzodiazepine—antibody conjugates
US10010624B2 (en) 2013-10-11 2018-07-03 Medimmune Limited Pyrrolobenzodiazepine-antibody conjugates
US10029018B2 (en) 2013-10-11 2018-07-24 Medimmune Limited Pyrrolobenzodiazepines and conjugates thereof
WO2018206715A2 (en) 2017-05-09 2018-11-15 Cyano Biotech Gmbh Modified microcystins and nodularins
WO2018219619A1 (en) 2017-05-09 2018-12-06 Cyano Biotech Gmbh Method for modifying microcystins and nodularins
WO2019060398A1 (en) 2017-09-20 2019-03-28 Ph Pharma Co., Ltd. Thailanstatin analogs
US10392393B2 (en) 2016-01-26 2019-08-27 Medimmune Limited Pyrrolobenzodiazepines
US10420777B2 (en) 2014-09-12 2019-09-24 Medimmune Limited Pyrrolobenzodiazepines and conjugates thereof
US10543279B2 (en) 2016-04-29 2020-01-28 Medimmune Limited Pyrrolobenzodiazepine conjugates and their use for the treatment of cancer
US10544223B2 (en) 2017-04-20 2020-01-28 Adc Therapeutics Sa Combination therapy with an anti-axl antibody-drug conjugate
WO2020049286A1 (en) 2018-09-03 2020-03-12 Femtogenix Limited Polycyclic amides as cytotoxic agents
WO2020086858A1 (en) 2018-10-24 2020-04-30 Genentech, Inc. Conjugated chemical inducers of degradation and methods of use
WO2020123275A1 (en) 2018-12-10 2020-06-18 Genentech, Inc. Photocrosslinking peptides for site specific conjugation to fc-containing proteins
US10695433B2 (en) 2012-10-12 2020-06-30 Medimmune Limited Pyrrolobenzodiazepine-antibody conjugates
US10695439B2 (en) 2016-02-10 2020-06-30 Medimmune Limited Pyrrolobenzodiazepine conjugates
WO2020157491A1 (en) 2019-01-29 2020-08-06 Femtogenix Limited G-a crosslinking cytotoxic agents
US10736903B2 (en) 2012-10-12 2020-08-11 Medimmune Limited Pyrrolobenzodiazepine-anti-PSMA antibody conjugates
US10751346B2 (en) 2012-10-12 2020-08-25 Medimmune Limited Pyrrolobenzodiazepine—anti-PSMA antibody conjugates
US10780096B2 (en) 2014-11-25 2020-09-22 Adc Therapeutics Sa Pyrrolobenzodiazepine-antibody conjugates
US10799595B2 (en) 2016-10-14 2020-10-13 Medimmune Limited Pyrrolobenzodiazepine conjugates
US11059893B2 (en) 2015-04-15 2021-07-13 Bergenbio Asa Humanized anti-AXL antibodies
US11135303B2 (en) 2011-10-14 2021-10-05 Medimmune Limited Pyrrolobenzodiazepines and conjugates thereof
US11160872B2 (en) 2017-02-08 2021-11-02 Adc Therapeutics Sa Pyrrolobenzodiazepine-antibody conjugates
WO2022023735A1 (en) 2020-07-28 2022-02-03 Femtogenix Limited Cytotoxic agents
US11318211B2 (en) 2017-06-14 2022-05-03 Adc Therapeutics Sa Dosage regimes for the administration of an anti-CD19 ADC
US11352324B2 (en) 2018-03-01 2022-06-07 Medimmune Limited Methods
US11370801B2 (en) 2017-04-18 2022-06-28 Medimmune Limited Pyrrolobenzodiazepine conjugates
US11517626B2 (en) 2016-02-10 2022-12-06 Medimmune Limited Pyrrolobenzodiazepine antibody conjugates
US11524969B2 (en) 2018-04-12 2022-12-13 Medimmune Limited Pyrrolobenzodiazepines and conjugates thereof as antitumour agents
US11612665B2 (en) 2017-02-08 2023-03-28 Medimmune Limited Pyrrolobenzodiazepine-antibody conjugates
US11649250B2 (en) 2017-08-18 2023-05-16 Medimmune Limited Pyrrolobenzodiazepine conjugates
US11702473B2 (en) 2015-04-15 2023-07-18 Medimmune Limited Site-specific antibody-drug conjugates

Families Citing this family (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
FR2767135B1 (en) * 1997-08-06 2002-07-12 Genset Sa LSR COMPLEX RECEPTOR, ACTIVITY, CLONING, AND APPLICATION TO DIAGNOSIS, PREVENTION AND / OR TREATMENT OF OBESITY AND THE RISKS OR COMPLICATIONS THEREOF
US20050054565A1 (en) * 2001-07-31 2005-03-10 John Lucas Agonists and antagonists of moxifin for the treatment of metabolic disorders
EP1418934A1 (en) 2001-08-02 2004-05-19 Genset S.A. Xobesin agonists and antagonists for the treatment of metabolic disorders
AU2002339673A1 (en) * 2001-11-28 2003-06-10 Genset S.A. Agonists and antagonists of ryzn for the treatment of metabolic disorders

Citations (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1999059618A1 (en) * 1998-05-21 1999-11-25 Smithkline Beecham Corporation Acrp30r1l, a homolog of acrp30 (30 kd adipocyte complement-related protein)
EP1033134A1 (en) * 1997-10-29 2000-09-06 Otsuka Pharmaceutical Co., Ltd. Compositions inhibiting smooth muscle proliferation, method for the diagnosis of arteriosclerosis, and kits therefor
WO2000068380A2 (en) * 1999-05-11 2000-11-16 Incyte Genomics, Inc. Extracellular matrix and adhesion-associated proteins
WO2000073448A1 (en) * 1999-05-27 2000-12-07 Zymogenetics, Inc. Adipocyte complement related protein homolog zacrp7
WO2001051645A1 (en) * 2000-01-14 2001-07-19 Genset Obg3 globular head and uses thereof for decreasing body mass
WO2002038766A2 (en) * 2000-11-07 2002-05-16 Zymogenetics, Inc. Human tumor necrosis factor receptor

Family Cites Families (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
FR2767135B1 (en) 1997-08-06 2002-07-12 Genset Sa LSR COMPLEX RECEPTOR, ACTIVITY, CLONING, AND APPLICATION TO DIAGNOSIS, PREVENTION AND / OR TREATMENT OF OBESITY AND THE RISKS OR COMPLICATIONS THEREOF
US20020058617A1 (en) 2000-01-14 2002-05-16 Joachim Fruebis OBG3 globular head and uses thereof for decreasing body mass
US6989367B2 (en) 2000-01-14 2006-01-24 Genset S.A. OBG3 globular head and uses thereof
US6566332B2 (en) 2000-01-14 2003-05-20 Genset S.A. OBG3 globular head and uses thereof for decreasing body mass
US6579852B2 (en) 2000-01-14 2003-06-17 Genset S.A. OBG3 globular head and uses thereof for decreasing body mass
US20030224501A1 (en) 2000-03-17 2003-12-04 Young Paul E. Bone morphogenic protein polynucleotides, polypeptides, and antibodies
US20030215836A1 (en) 2000-03-17 2003-11-20 Young Paul E. Bone morphogenic protein polynucleotides, polypeptides, and antibodies
US6867189B2 (en) 2001-07-26 2005-03-15 Genset S.A. Use of adipsin/complement factor D in the treatment of metabolic related disorders
US20050054565A1 (en) 2001-07-31 2005-03-10 John Lucas Agonists and antagonists of moxifin for the treatment of metabolic disorders
EP1418934A1 (en) 2001-08-02 2004-05-19 Genset S.A. Xobesin agonists and antagonists for the treatment of metabolic disorders
AU2002339673A1 (en) 2001-11-28 2003-06-10 Genset S.A. Agonists and antagonists of ryzn for the treatment of metabolic disorders

Patent Citations (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP1033134A1 (en) * 1997-10-29 2000-09-06 Otsuka Pharmaceutical Co., Ltd. Compositions inhibiting smooth muscle proliferation, method for the diagnosis of arteriosclerosis, and kits therefor
WO1999059618A1 (en) * 1998-05-21 1999-11-25 Smithkline Beecham Corporation Acrp30r1l, a homolog of acrp30 (30 kd adipocyte complement-related protein)
WO2000068380A2 (en) * 1999-05-11 2000-11-16 Incyte Genomics, Inc. Extracellular matrix and adhesion-associated proteins
WO2000073448A1 (en) * 1999-05-27 2000-12-07 Zymogenetics, Inc. Adipocyte complement related protein homolog zacrp7
WO2001051645A1 (en) * 2000-01-14 2001-07-19 Genset Obg3 globular head and uses thereof for decreasing body mass
WO2002038766A2 (en) * 2000-11-07 2002-05-16 Zymogenetics, Inc. Human tumor necrosis factor receptor

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
THOMPSON J S ET AL: "BAFF-R, a newly identified TNF receptor that specifically interacts with BAFF", SCIENCE, AMERICAN ASSOCIATION FOR THE ADVANCEMENT OF SCIENCE,, US, vol. 293, no. 5537, 14 September 2001 (2001-09-14), pages 2108 - 2111, XP002206614, ISSN: 0036-8075 *
YAN M ET AL: "Identification of a novel receptor for B lymphocyte stimulator that is mutated in a mouse strain with severe B cell deficiency", CURRENT BIOLOGY, CURRENT SCIENCE,, GB, vol. 11, no. 19, 2001, pages 1547 - 1552, XP002206615, ISSN: 0960-9822 *

Cited By (94)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7112410B1 (en) 2001-08-29 2006-09-26 Human Genome Sciences, Inc. Human tumor necrosis factor TR21 and methods based thereon
EP2489364A1 (en) 2003-11-06 2012-08-22 Seattle Genetics, Inc. Monomethylvaline compounds onjugated to antibodies
EP2260858A2 (en) 2003-11-06 2010-12-15 Seattle Genetics, Inc. Monomethylvaline compounds capable of conjugation to ligands
EP3858387A1 (en) 2003-11-06 2021-08-04 Seagen Inc. Monomethylvaline compounds capable of conjugation to ligands
EP3434275A1 (en) 2003-11-06 2019-01-30 Seattle Genetics, Inc. Assay for cancer cells based on the use of auristatin conjugates with antibodies
EP2478912A1 (en) 2003-11-06 2012-07-25 Seattle Genetics, Inc. Auristatin conjugates with anti-HER2 or anti-CD22 antibodies and their use in therapy
EP2486933A1 (en) 2003-11-06 2012-08-15 Seattle Genetics, Inc. Monomethylvaline compounds conjugated with antibodies
EP2286844A2 (en) 2004-06-01 2011-02-23 Genentech, Inc. Antibody-drug conjugates and methods
EP3088004A1 (en) 2004-09-23 2016-11-02 Genentech, Inc. Cysteine engineered antibodies and conjugates
WO2011031870A1 (en) 2009-09-09 2011-03-17 Centrose, Llc Extracellular targeted drug conjugates
WO2011056983A1 (en) 2009-11-05 2011-05-12 Genentech, Inc. Zirconium-radiolabeled, cysteine engineered antibody conjugates
WO2011130598A1 (en) 2010-04-15 2011-10-20 Spirogen Limited Pyrrolobenzodiazepines and conjugates thereof
WO2011156328A1 (en) 2010-06-08 2011-12-15 Genentech, Inc. Cysteine engineered antibodies and conjugates
WO2012074757A1 (en) 2010-11-17 2012-06-07 Genentech, Inc. Alaninyl maytansinol antibody conjugates
WO2012155019A1 (en) 2011-05-12 2012-11-15 Genentech, Inc. Multiple reaction monitoring lc-ms/ms method to detect therapeutic antibodies in animal samples using framework signature pepides
US11135303B2 (en) 2011-10-14 2021-10-05 Medimmune Limited Pyrrolobenzodiazepines and conjugates thereof
WO2013130093A1 (en) 2012-03-02 2013-09-06 Genentech, Inc. Biomarkers for treatment with anti-tubulin chemotherapeutic compounds
US11779650B2 (en) 2012-10-12 2023-10-10 Medimmune Limited Pyrrolobenzodiazepine-antibody conjugates
US10722594B2 (en) 2012-10-12 2020-07-28 Adc Therapeutics S.A. Pyrrolobenzodiazepine-anti-CD22 antibody conjugates
WO2014057074A1 (en) 2012-10-12 2014-04-17 Spirogen Sàrl Pyrrolobenzodiazepines and conjugates thereof
US10646584B2 (en) 2012-10-12 2020-05-12 Medimmune Limited Pyrrolobenzodiazepines and conjugates thereof
US10695433B2 (en) 2012-10-12 2020-06-30 Medimmune Limited Pyrrolobenzodiazepine-antibody conjugates
EP2839860A1 (en) 2012-10-12 2015-02-25 Spirogen Sàrl Pyrrolobenzodiazepines and conjugates thereof
US9931415B2 (en) 2012-10-12 2018-04-03 Medimmune Limited Pyrrolobenzodiazepine-antibody conjugates
US10335497B2 (en) 2012-10-12 2019-07-02 Medimmune Limited Pyrrolobenzodiazepines and conjugates thereof
US11771775B2 (en) 2012-10-12 2023-10-03 Medimmune Limited Pyrrolobenzodiazepine-antibody conjugates
US9931414B2 (en) 2012-10-12 2018-04-03 Medimmune Limited Pyrrolobenzodiazepine-antibody conjugates
US9919056B2 (en) 2012-10-12 2018-03-20 Adc Therapeutics S.A. Pyrrolobenzodiazepine-anti-CD22 antibody conjugates
US10736903B2 (en) 2012-10-12 2020-08-11 Medimmune Limited Pyrrolobenzodiazepine-anti-PSMA antibody conjugates
US11701430B2 (en) 2012-10-12 2023-07-18 Medimmune Limited Pyrrolobenzodiazepines and conjugates thereof
US11690918B2 (en) 2012-10-12 2023-07-04 Medimmune Limited Pyrrolobenzodiazepine-anti-CD22 antibody conjugates
US9889207B2 (en) 2012-10-12 2018-02-13 Medimmune Limited Pyrrolobenzodiazepines and conjugates thereof
US10751346B2 (en) 2012-10-12 2020-08-25 Medimmune Limited Pyrrolobenzodiazepine—anti-PSMA antibody conjugates
US10994023B2 (en) 2012-10-12 2021-05-04 Medimmune Limited Pyrrolobenzodiazepines and conjugates thereof
US10799596B2 (en) 2012-10-12 2020-10-13 Adc Therapeutics S.A. Pyrrolobenzodiazepine-antibody conjugates
US10780181B2 (en) 2012-10-12 2020-09-22 Medimmune Limited Pyrrolobenzodiazepine-antibody conjugates
US9567340B2 (en) 2012-12-21 2017-02-14 Medimmune Limited Unsymmetrical pyrrolobenzodiazepines-dimers for use in the treatment of proliferative and autoimmune diseases
US9562049B2 (en) 2012-12-21 2017-02-07 Medimmune Limited Pyrrolobenzodiazepines and conjugates thereof
WO2014140862A2 (en) 2013-03-13 2014-09-18 Spirogen Sarl Pyrrolobenzodiazepines and conjugates thereof
WO2014140174A1 (en) 2013-03-13 2014-09-18 Spirogen Sàrl Pyrrolobenzodiazepines and conjugates thereof
WO2014159981A2 (en) 2013-03-13 2014-10-02 Spirogen Sarl Pyrrolobenzodiazepines and conjugates thereof
WO2015023355A1 (en) 2013-08-12 2015-02-19 Genentech, Inc. 1-(chloromethyl)-2,3-dihydro-1h-benzo[e]indole dimer antibody-drug conjugate compounds, and methods of use and treatment
US10010624B2 (en) 2013-10-11 2018-07-03 Medimmune Limited Pyrrolobenzodiazepine-antibody conjugates
US9950078B2 (en) 2013-10-11 2018-04-24 Medimmune Limited Pyrrolobenzodiazepine-antibody conjugates
US9956299B2 (en) 2013-10-11 2018-05-01 Medimmune Limited Pyrrolobenzodiazepine—antibody conjugates
US10029018B2 (en) 2013-10-11 2018-07-24 Medimmune Limited Pyrrolobenzodiazepines and conjugates thereof
WO2015095212A1 (en) 2013-12-16 2015-06-25 Genentech, Inc. 1-(chloromethyl)-2,3-dihydro-1h-benzo[e]indole dimer antibody-drug conjugate compounds, and methods of use and treatment
WO2015095227A2 (en) 2013-12-16 2015-06-25 Genentech, Inc. Peptidomimetic compounds and antibody-drug conjugates thereof
WO2015095223A2 (en) 2013-12-16 2015-06-25 Genentech, Inc. Peptidomimetic compounds and antibody-drug conjugates thereof
WO2016037644A1 (en) 2014-09-10 2016-03-17 Medimmune Limited Pyrrolobenzodiazepines and conjugates thereof
US10188746B2 (en) 2014-09-10 2019-01-29 Medimmune Limited Pyrrolobenzodiazepines and conjugates thereof
WO2016040856A2 (en) 2014-09-12 2016-03-17 Genentech, Inc. Cysteine engineered antibodies and conjugates
US10420777B2 (en) 2014-09-12 2019-09-24 Medimmune Limited Pyrrolobenzodiazepines and conjugates thereof
WO2016040825A1 (en) 2014-09-12 2016-03-17 Genentech, Inc. Anthracycline disulfide intermediates, antibody-drug conjugates and methods
EP3235820A1 (en) 2014-09-17 2017-10-25 Genentech, Inc. Pyrrolobenzodiazepines and antibody disulfide conjugates thereof
US10780096B2 (en) 2014-11-25 2020-09-22 Adc Therapeutics Sa Pyrrolobenzodiazepine-antibody conjugates
WO2016090050A1 (en) 2014-12-03 2016-06-09 Genentech, Inc. Quaternary amine compounds and antibody-drug conjugates thereof
US11702473B2 (en) 2015-04-15 2023-07-18 Medimmune Limited Site-specific antibody-drug conjugates
US11059893B2 (en) 2015-04-15 2021-07-13 Bergenbio Asa Humanized anti-AXL antibodies
WO2017059289A1 (en) 2015-10-02 2017-04-06 Genentech, Inc. Pyrrolobenzodiazepine antibody drug conjugates and methods of use
WO2017064675A1 (en) 2015-10-16 2017-04-20 Genentech, Inc. Hindered disulfide drug conjugates
WO2017068511A1 (en) 2015-10-20 2017-04-27 Genentech, Inc. Calicheamicin-antibody-drug conjugates and methods of use
US10392393B2 (en) 2016-01-26 2019-08-27 Medimmune Limited Pyrrolobenzodiazepines
US10695439B2 (en) 2016-02-10 2020-06-30 Medimmune Limited Pyrrolobenzodiazepine conjugates
US11517626B2 (en) 2016-02-10 2022-12-06 Medimmune Limited Pyrrolobenzodiazepine antibody conjugates
WO2017165734A1 (en) 2016-03-25 2017-09-28 Genentech, Inc. Multiplexed total antibody and antibody-conjugated drug quantification assay
EP4273551A2 (en) 2016-03-25 2023-11-08 F. Hoffmann-La Roche AG Multiplexed total antibody and antibody-conjugated drug quantification assay
US10543279B2 (en) 2016-04-29 2020-01-28 Medimmune Limited Pyrrolobenzodiazepine conjugates and their use for the treatment of cancer
WO2017201449A1 (en) 2016-05-20 2017-11-23 Genentech, Inc. Protac antibody conjugates and methods of use
WO2017205741A1 (en) 2016-05-27 2017-11-30 Genentech, Inc. Bioanalytical method for the characterization of site-specific antibody-drug conjugates
WO2017214024A1 (en) 2016-06-06 2017-12-14 Genentech, Inc. Silvestrol antibody-drug conjugates and methods of use
WO2018031662A1 (en) 2016-08-11 2018-02-15 Genentech, Inc. Pyrrolobenzodiazepine prodrugs and antibody conjugates thereof
WO2018065501A1 (en) 2016-10-05 2018-04-12 F. Hoffmann-La Roche Ag Methods for preparing antibody drug conjugates
US10799595B2 (en) 2016-10-14 2020-10-13 Medimmune Limited Pyrrolobenzodiazepine conjugates
US11813335B2 (en) 2017-02-08 2023-11-14 Medimmune Limited Pyrrolobenzodiazepine-antibody conjugates
US11160872B2 (en) 2017-02-08 2021-11-02 Adc Therapeutics Sa Pyrrolobenzodiazepine-antibody conjugates
US11612665B2 (en) 2017-02-08 2023-03-28 Medimmune Limited Pyrrolobenzodiazepine-antibody conjugates
US11370801B2 (en) 2017-04-18 2022-06-28 Medimmune Limited Pyrrolobenzodiazepine conjugates
US10544223B2 (en) 2017-04-20 2020-01-28 Adc Therapeutics Sa Combination therapy with an anti-axl antibody-drug conjugate
US11124818B2 (en) 2017-05-09 2021-09-21 Cyano Biotech Gmbh Method for modifying microcystins and nodularins
WO2018206715A2 (en) 2017-05-09 2018-11-15 Cyano Biotech Gmbh Modified microcystins and nodularins
US11512114B2 (en) 2017-05-09 2022-11-29 Cyano Biotech Gmbh Modified microcystins and nodularins
WO2018219619A1 (en) 2017-05-09 2018-12-06 Cyano Biotech Gmbh Method for modifying microcystins and nodularins
US11318211B2 (en) 2017-06-14 2022-05-03 Adc Therapeutics Sa Dosage regimes for the administration of an anti-CD19 ADC
US11938192B2 (en) 2017-06-14 2024-03-26 Medimmune Limited Dosage regimes for the administration of an anti-CD19 ADC
US11649250B2 (en) 2017-08-18 2023-05-16 Medimmune Limited Pyrrolobenzodiazepine conjugates
WO2019060398A1 (en) 2017-09-20 2019-03-28 Ph Pharma Co., Ltd. Thailanstatin analogs
US11352324B2 (en) 2018-03-01 2022-06-07 Medimmune Limited Methods
US11524969B2 (en) 2018-04-12 2022-12-13 Medimmune Limited Pyrrolobenzodiazepines and conjugates thereof as antitumour agents
WO2020049286A1 (en) 2018-09-03 2020-03-12 Femtogenix Limited Polycyclic amides as cytotoxic agents
WO2020086858A1 (en) 2018-10-24 2020-04-30 Genentech, Inc. Conjugated chemical inducers of degradation and methods of use
WO2020123275A1 (en) 2018-12-10 2020-06-18 Genentech, Inc. Photocrosslinking peptides for site specific conjugation to fc-containing proteins
WO2020157491A1 (en) 2019-01-29 2020-08-06 Femtogenix Limited G-a crosslinking cytotoxic agents
WO2022023735A1 (en) 2020-07-28 2022-02-03 Femtogenix Limited Cytotoxic agents

Also Published As

Publication number Publication date
US20050069971A1 (en) 2005-03-31
US7344843B2 (en) 2008-03-18
EP1448226A1 (en) 2004-08-25
AU2002339691A1 (en) 2003-06-10

Similar Documents

Publication Publication Date Title
US7344843B2 (en) Agonists and antagonists of prolixin for the treatment of metabolic disorders
Li et al. Crosstalk between adipose tissue and the heart: An update
US7276342B2 (en) Xobesin agonists and antagonists for the treatment of metabolic disorders
US20070129291A1 (en) Genobix agonists and antagonists for use in the treatment of metabolic disorders
US20060089311A1 (en) Agonists and antagonists of ryzn for the treatment of metabolic disorders
US20050054565A1 (en) Agonists and antagonists of moxifin for the treatment of metabolic disorders
WO2003049758A1 (en) Emergen agonists and antagonists for use in the treatment of metabolic disorders
WO2003013578A1 (en) Omoxin agonists and antagonists for use in the treatment of metabolic disorders
WO2003009865A1 (en) Agonists and antagonists of energen for use in the treatment of metabolic disorders
WO2003013582A1 (en) Genoxit agonists and antagonists for use in the treatment of metabolic disorders
WO2003011325A1 (en) Agonists and antagonists of moceptin for the treatment of metabolic disorders
WO2003055509A1 (en) Agonists and antagonists of bromix for the treatment of metabolic disorders
WO2003013583A1 (en) Faxigen agonists and antagonists in the treatment of metabolic disorders
WO2003049757A1 (en) Agonists and antagonists of glucomin for the treatment of metabolic disorders
WO2003011318A1 (en) Agonists and antagonists of famoset for use in the treatment of metabolic disorders
WO2003009862A1 (en) Agonists and antagonists of modumet for use in the treatment of metabolic disorders
WO2003009861A1 (en) Agonists and antagonists of metabolix in the treatment of metabolic disorders
WO2003013604A2 (en) Migenix agonists and antagonists for use in the treatment of metabolic disorders
WO2003011323A1 (en) Agonists and antagonists of contabix for use in the treatment of metabolic disorders
WO2003013581A1 (en) Agonists and antagonists of genceptin for the treatment of metabolic disorders
WO2003011321A1 (en) Agonists and antagonists of cobesin for the treatment of metabolic disorders
WO2003013585A1 (en) Mifaxin agonists and antagonists for use in the treatment of metabolic
WO2003011322A1 (en) Agonists and antagonists of genoxin for use in the treatment of metabolic disorders
WO2003009863A1 (en) Agonists and antagonists of cofoxin for use in the treatment of metabolic disorders
WO2003011320A1 (en) Agonists and antagonists of obesingen for the treatment of metabolic disorders

Legal Events

Date Code Title Description
AK Designated states

Kind code of ref document: A1

Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NO NZ OM PH PL PT RO RU SD SE SG SI SK SL TJ TM TN TR TT TZ UA UG US UZ VN YU ZA ZM ZW

AL Designated countries for regional patents

Kind code of ref document: A1

Designated state(s): GH GM KE LS MW MZ SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE BG CH CY CZ DE DK EE ES FI FR GB GR IE IT LU MC NL PT SE SK TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG

121 Ep: the epo has been informed by wipo that ep was designated in this application
WWE Wipo information: entry into national phase

Ref document number: 2002777740

Country of ref document: EP

WWP Wipo information: published in national office

Ref document number: 2002777740

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 10496757

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: JP

WWW Wipo information: withdrawn in national office

Country of ref document: JP

WWW Wipo information: withdrawn in national office

Ref document number: 2002777740

Country of ref document: EP